BioLiP

>protein
GSKKKLERLYGRYKDPQDENKIGVDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKEFLDGMTELGCDSMEKLKA
LLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAYWKLVLSGRFKFLDLWNTFLMEHHKRSIPRDTWNLLLDF
GNMIADDMSNYDEEGAWPVLIDDFVEYARPVVT

The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4gao:A	193	193	1.0000	1.0000	1.0000	1.31e-144	4gao:B, 4gao:D, 4gao:G
2	6p5v:A	373	191	0.8187	0.4236	0.8272	4.76e-121	6b5q:A, 6b5q:B, 6bg3:A, 6bg5:A, 4i7p:A, 7kwa:A, 6p5w:A, 3tdu:B, 3tdu:A, 3tdz:A, 3tdz:B, 5ufi:A, 5ufi:B, 5ufi:C, 5ufi:D, 5v83:A, 5v86:A, 5v88:A, 6xol:A, 6xom:A, 6xon:A, 6xoo:A, 6xop:A, 6xoq:A
3	4gba:B	206	189	0.4508	0.4223	0.4603	3.94e-52	4gba:A
4	3tdi:A	202	194	0.2694	0.2574	0.2680	6.14e-18	3tdi:B
5	4oja:A	149	94	0.1399	0.1812	0.2872	0.089
6	9iuk:A	1335	76	0.1036	0.0150	0.2632	0.96	9iul:A, 9ium:A
7	6vxe:A	789	110	0.1451	0.0355	0.2545	1.0	6vxe:B, 6vxe:C, 6vxe:D, 6vxe:E, 6vxe:F, 6vxe:G, 6vxe:H
8	2c0k:A	150	32	0.0570	0.0733	0.3438	4.0	2c0k:B
9	1a0e:A	443	31	0.0570	0.0248	0.3548	4.1	1a0e:D
10	8wkq:Q	134	71	0.0984	0.1418	0.2676	9.0	8wkq:R, 8wkq:S, 8wkq:T, 8wkq:U, 8wl2:A6, 8wl2:A7, 8wl2:A8, 8wl2:A9, 8wl2:A0, 8wln:Q, 8wln:R, 8wln:S, 8wln:T, 8wln:U, 8wlt:A6, 8wlt:A7, 8wlt:A8, 8wlt:A9, 8wlt:A0, 8wo5:A6, 8wo5:A7, 8wo5:A8, 8wo5:A9, 8wo5:A0, 8woe:A6, 8woe:A7, 8woe:A8, 8woe:A9, 8woe:A0

[Back]