BioLiP

>protein
GSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGK
FLAFYQYASFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLN
LTHV

The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7q50:A	170	165	1.0000	0.9647	0.9939	7.79e-121	6cct:A, 6ccu:A, 6cd8:A, 6cd8:B, 6cd9:A, 6cdc:A, 6cdg:A, 7s12:A, 7slz:A, 7u3e:A, 7u3e:B, 7u3f:A, 7u3g:A, 7u3h:A, 7u3i:A, 7u3i:B, 7u3j:A, 7u3k:A, 7u3l:A, 8v1p:A, 6wzx:A, 6wzx:B, 6wzz:A
2	7ns3:4	199	179	0.3720	0.3065	0.3408	6.40e-27
3	7qqy:A	216	192	0.3780	0.2870	0.3229	1.51e-23	7q51:A
4	6ihr:A	257	116	0.1768	0.1128	0.2500	0.20	5f1m:A, 6ihl:A, 6ihs:A, 6iht:A, 6ihw:A
5	3cew:A	118	58	0.1159	0.1610	0.3276	0.35	3cew:B, 3cew:C, 3cew:D
6	5ykb:D	523	83	0.1037	0.0325	0.2048	1.4	5ykb:B
7	4eu2:N	233	69	0.0976	0.0687	0.2319	2.4	5d0t:M, 4eu2:2, 5l5w:M, 4q1s:a, 4q1s:M
8	3bxu:A	71	47	0.0854	0.1972	0.2979	3.1	3bxu:B
9	4n7t:A	402	97	0.1524	0.0622	0.2577	3.8	3m7v:A, 3m7v:B, 4n7t:B
10	6g21:A	504	28	0.0732	0.0238	0.4286	5.0	6g21:B
11	6j15:D	106	35	0.0610	0.0943	0.2857	8.3
12	6jjp:F	118	35	0.0610	0.0847	0.2857	9.0	8as0:A, 8as0:F, 8as0:I, 8as0:L, 8as0:O, 8as0:R, 8as0:X, 8as0:Y, 7cu5:Q, 6j15:C, 6jbt:F, 6jjp:C, 6umt:A, 5wt9:G

[Back]