GSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWACSA
PKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQ
EFNLIDRRELAPLQELIEK
The query sequence (length=179) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5brk:A | 194 | 180 | 0.9330 | 0.8608 | 0.9278 | 5.32e-125 | 5b5v:A, 5b5v:C, 5b5v:B, 5b5v:D, 5b5w:A, 5b6b:A, 5b6b:B, 5b6b:D, 5b6b:F, 5b6b:H, 5b6b:K, 5b6b:M, 5b6b:O, 5brm:A, 5brm:B, 5brm:C, 5brm:D, 5brm:E, 5brm:F, 4j1v:A, 4j1v:C, 4jiz:A, 6mcp:B, 6mcp:D, 6mcq:B, 6mcq:D, 1pi1:A, 5twf:A, 5twf:B, 5twg:A, 5twh:A, 5xqz:A, 5xqz:B |
2 | 2hjn:A | 206 | 189 | 0.5531 | 0.4806 | 0.5238 | 5.01e-62 | 5ncn:A |
3 | 5ncm:A | 183 | 171 | 0.4022 | 0.3934 | 0.4211 | 2.11e-50 | |
4 | 7k36:H | 177 | 145 | 0.1899 | 0.1921 | 0.2345 | 2.52e-04 | |
5 | 5yf4:A | 129 | 144 | 0.1788 | 0.2481 | 0.2222 | 1.0 | |
6 | 1rv3:B | 466 | 60 | 0.0782 | 0.0300 | 0.2333 | 3.5 | 1cj0:A, 1ls3:A, 1ls3:B, 1ls3:C, 1ls3:D, 1rv3:A, 1rv4:A, 1rv4:B, 1rvu:A, 1rvu:B, 1rvy:A, 1rvy:B |
7 | 4krg:A | 466 | 22 | 0.0503 | 0.0193 | 0.4091 | 5.0 | 4krg:B |
8 | 3eo3:A | 288 | 95 | 0.1173 | 0.0729 | 0.2211 | 6.7 | 3eo3:B, 3eo3:C |
9 | 2vea:A | 500 | 42 | 0.0726 | 0.0260 | 0.3095 | 9.1 |