Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
GSHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFD
VVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPQLALWKGDTSKANLYVDDVYLVEV

The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2zew:B 147 147 1.0000 1.0000 1.0000 1.76e-107 3oea:A, 3oea:B, 3oeb:A, 2zew:A, 2zex:A, 2zex:B, 2zey:B, 2zey:A
2 2zez:C 143 141 0.5986 0.6154 0.6241 4.12e-62 2zez:A, 2zez:B, 2zez:D
3 5mab:A 259 33 0.0748 0.0425 0.3333 2.1 5mab:B, 5mab:C, 5mvo:A, 5mvo:B, 5mvo:C
4 5kzw:A 850 33 0.0816 0.0141 0.3636 2.2 8cb1:A, 8cb6:A, 5kzx:A, 5nn4:A, 5nn5:A, 5nn6:A, 5nn8:A, 7p2z:AaA, 7p32:AAA
5 7ea4:A 762 71 0.1361 0.0262 0.2817 3.3 7ea4:B, 7eby:A, 7eby:B, 7eby:C, 7eby:D, 7eby:E, 7eby:F
6 5y7p:A 327 83 0.1020 0.0459 0.1807 5.6 8bls:A, 8bls:B, 8bls:C, 8bls:D, 8bls:E, 8bls:F, 8bls:G, 8bls:H, 8blt:A, 8blt:B, 8blt:C, 8blt:D, 8blt:E, 8blt:F, 8blt:G, 8blt:H, 5y7p:F
7 4x30:A 372 35 0.1020 0.0403 0.4286 6.8 2ceo:A, 2ceo:B, 2riw:A, 2riw:B, 2xn3:A, 2xn3:B, 2xn5:A, 2xn6:A, 2xn6:B, 2xn7:A, 2xn7:B, 4yia:A, 4yia:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218