BioLiP

>protein
GSHMREIIERVKEKTTIPVYERTIENVLSAIQASGDVWRIVDLSEEPLPLVVAVVTALYELGYVAFENNQVILTRKGKEL
VEKYGIGPRADYTCSHCQGRTVEIDAFSELLEQFKEITRDRPEPAHQFDQAYVTPETTVARVALMHSRGDLENKEVFVLG
DDDLTSVALMLSGLPKRIAVLDIDERLTKFIEKAADEIGYENIEIFTFDLRKPLPDYALHKFDTFITDPPETVEAIRAFV
GRGIATLKGPGCAGYFGITRRESSLDKWREIQRVLLNEFGVVITDIIRNFNEYVNWGYVEETRAWRLLPIKVKPSYNWYK
SYMFRIQTLEGSKGFEDEITVGQELYDDEESSTT

The query sequence (length=354) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5xnc:B	354	354	1.0000	1.0000	1.0000	0.0	6j26:A, 6j26:B, 5xnc:A, 5xnc:C, 5xnc:D, 5xnc:E, 5xnc:F, 5xnc:G, 5xnf:A, 5xnf:B, 5xnh:A, 5xnh:H
2	2qm3:A	338	339	0.7571	0.7929	0.7906	0.0
3	6j28:A	345	350	0.4294	0.4406	0.4343	5.38e-91	6j27:A, 6j27:B, 6j27:C, 6j27:D, 6j28:C, 6j28:B, 6j28:D
4	1woo:A	362	87	0.0763	0.0746	0.3103	0.76	1wop:A, 1wor:A
5	4mnd:A	408	114	0.0819	0.0711	0.2544	1.6
6	6h2v:A	210	110	0.0819	0.1381	0.2636	2.0	6h2u:A, 6h2v:C
7	1dgj:A	906	58	0.0508	0.0199	0.3103	2.6
8	8a8k:A	317	65	0.0593	0.0662	0.3231	3.1	8a8k:B, 8a8k:C, 8a8k:D, 8a8k:E, 8a8k:F
9	8ro2:C	908	28	0.0339	0.0132	0.4286	7.6	7aav:r, 7abf:r, 7abg:r, 7abi:r, 6ah0:C, 6ahd:C, 8c6j:C, 8ch6:b, 7dvq:C, 6ff4:B, 6ff7:B, 9fmd:C, 8h6e:5C, 8h6j:5C, 8h6k:5C, 8h6l:5C, 8i0p:C, 8i0r:C, 8i0s:C, 8i0t:C, 8i0u:C, 8i0v:C, 8i0w:C, 6icz:C, 6id0:C, 6id1:C, 8q7q:C, 8q7v:C, 8q7w:C, 8q7x:C, 8q91:C, 6qdv:C, 8qp8:C, 7qtt:b, 6qw6:5C, 6qx9:5C, 8rc0:C, 7w59:C, 7w5a:C, 7w5b:C, 5xjc:C, 8y6o:D, 5yzg:C, 5z56:C, 5z57:C, 5z58:C, 6zym:B
10	1d06:A	130	76	0.0565	0.1538	0.2632	7.9	1ew0:A
11	6epc:R	389	71	0.0537	0.0488	0.2676	9.8	6epd:R, 6epe:R, 6epf:R, 5ln3:R, 5t0h:Y, 5vft:Y

[Back]