BioLiP

>protein
GSHMEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYK
INAKLCDPHP

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ept:A	90	90	1.0000	1.0000	1.0000	1.63e-65	8enp:A, 2kr1:A, 6u19:B
2	4wai:A	91	31	0.1222	0.1209	0.3548	1.2	4wai:C, 4wai:B, 4wai:D
3	1uf2:A	967	65	0.1778	0.0165	0.2462	1.5
4	8id1:A	780	61	0.1889	0.0218	0.2787	2.1
5	5fi3:A	344	31	0.1444	0.0378	0.4194	4.0	5fi3:B, 5fi5:A, 5fi5:B
6	7s01:c	484	38	0.1333	0.0248	0.3158	5.1
7	8p5d:SR0	119	16	0.0889	0.0672	0.5000	5.4	8p60:SR0, 8p60:RR0, 7qca:SR0
8	3r3z:A	304	27	0.1444	0.0428	0.4815	5.5	6gxd:A, 6gxt:A, 5k3b:A, 5k3e:A, 6qhp:A, 6qhp:B, 6qhq:A, 6qhs:A, 6qht:A, 6qhu:A, 6qhv:A, 6qhw:A, 6qhw:B, 6qhx:A, 6qhx:B, 6qhy:A, 6qhz:A, 6qi0:A, 6qi0:B, 6qi1:A, 6qi2:A, 6qi3:A, 6qkt:A, 6qku:A, 6qkw:B, 3r3v:A, 3r3w:A, 3r3x:A, 3r3z:B, 3r3z:C, 3r3z:D, 5swn:A, 5t4t:B, 5t4t:A
9	3nu7:B	359	37	0.1333	0.0334	0.3243	6.7	3nu7:A, 3nub:A, 3nub:B, 3nys:A, 3nyt:A
10	2dc3:A	172	31	0.1111	0.0581	0.3226	9.1	3ag0:A, 4b3w:A, 4b3w:B, 2dc3:B, 1umo:A, 1umo:B, 1urv:A, 1urv:B, 1ury:A, 1ury:B, 1ut0:A, 1ut0:B, 1ux9:A, 1ux9:B, 1v5h:A

[Back]