BioLiP

>protein
GSHMEKIIKEKISSLLSQEEEVLSVEQLGGMTNQNYLAKTTNKQYIVKFFGKGTEKLINRQDEKYNLELLKDLGLDVKNY
LFDIEAGIKVNEYIESAITLDSTSIKTKFDKIAPILQTIHTSAKELRGEFAPFEEIKKYESLIEEQIPYANYESVRNAVF
SLEKRLADLGVDRKSCHIDLVPENFIESPQGRLYLIDWEYSSMNDPMWDLAALFLESEFTSQEEETFLSHYESDQTPVSH
EKIAIYKILQDTIWSLWTVYKEEQGEDFGDYGVNRYQRAVKGLASYG

The query sequence (length=287) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4r78:A	287	287	1.0000	1.0000	1.0000	0.0	4r7b:A, 4r7b:B
2	6yxs:A	359	335	0.2404	0.1922	0.2060	6.07e-06	3fi8:A, 6yxt:A
3	7s3l:A	254	154	0.1638	0.1850	0.3052	1.50e-05
4	3c5i:D	355	328	0.2404	0.1944	0.2104	0.005	3c5i:C, 3c5i:A, 3c5i:B
5	4pdy:A	332	63	0.0732	0.0633	0.3333	0.008
6	3mes:B	358	145	0.1115	0.0894	0.2207	0.25	3mes:A
7	3wub:A	313	69	0.0627	0.0575	0.2609	0.48	3wue:A, 3wuf:A, 3wug:A
8	3s1e:A	499	76	0.0627	0.0361	0.2368	0.70	3bw7:A, 3c0p:A, 3dq0:A, 3kjm:A, 2qkn:A, 2qpm:A, 3s1c:A, 3s1d:A, 3s1f:A, 1w1o:A, 1w1q:A, 1w1r:A, 1w1s:A
9	3lq3:A	339	160	0.1289	0.1091	0.2313	0.91	3feg:A
10	1nw1:A	365	305	0.2334	0.1836	0.2197	1.2	1nw1:B
11	8pm4:A	604	78	0.0697	0.0331	0.2564	3.7
12	7w7g:B	1711	72	0.0662	0.0111	0.2639	5.1
13	1uqw:A	487	148	0.1045	0.0616	0.2027	5.8	1uqw:B
14	4c2v:B	281	76	0.0871	0.0890	0.3289	6.1	4b8l:A, 4b8m:A, 4b8m:B, 2bfy:A, 2bfy:B, 4c2v:A, 4c2w:A, 4c2w:B, 5eyk:A, 5eyk:B, 5k3y:A, 5k3y:B, 2vgo:A, 2vgo:B, 2vgp:A, 2vgp:B, 2vrx:A, 2vrx:B, 3ztx:A, 3ztx:B
15	4pxg:A	466	130	0.1254	0.0773	0.2769	6.3	2reu:A, 7xm0:A, 7xm0:B, 7xm0:C
16	8tci:A	283	59	0.0662	0.0671	0.3220	10.0	8tci:D

[Back]