GSHMDGLLNPRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFVTDTLNFS
FWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALDEGIPITSASYYATVTLDQVRNILRSDTDVSMPLVEERHRILNETGK
ILLEKFGGSFLNCVRESENSAQKLMHLVVESFPSYRDVTLFEGKRVSFYKRAQILVADTWSVLEGKGDGCFKDISSITMF
ADYRLPQVLAHLGALKYSDDLLKKLLKGEMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDYYL
WDYAHDHREDMKGIPFHRIRCIYY
The query sequence (length=344) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dl3:B | 344 | 344 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8dl3:A |
2 | 7u5a:A | 323 | 332 | 0.3605 | 0.3839 | 0.3735 | 2.19e-74 | 7u1o:A, 7u1o:B, 7u5a:B, 7u91:A, 7u91:B, 7ulc:A, 7ulc:B |
3 | 3wbz:E | 268 | 142 | 0.0901 | 0.1157 | 0.2183 | 0.42 | 3wbz:A, 3wbz:B, 3wbz:C, 3wbz:D, 3wbz:F, 3wbz:G, 3wbz:H, 3wc0:A, 3wc0:B, 3wc0:C, 3wc0:D, 3wc0:E, 3wc0:F, 3wc0:G, 3wc0:H, 3wc0:I, 3wc0:J, 3wc0:K, 3wc0:L, 3wc0:M, 3wc0:N, 3wc0:O, 3wc0:P, 3wc1:A, 3wc1:B, 3wc1:C, 3wc1:D, 3wc2:A, 3wc2:B, 3wc2:C, 3wc2:D |
4 | 3nc6:B | 389 | 39 | 0.0407 | 0.0360 | 0.3590 | 1.1 | 3nc3:A, 3nc3:B, 3nc5:A, 3nc5:B, 3nc6:A, 3nc7:A, 3nc7:B |
5 | 1d8c:A | 709 | 105 | 0.0872 | 0.0423 | 0.2857 | 1.6 | 1p7t:A, 1p7t:B |
6 | 5csd:D | 159 | 52 | 0.0436 | 0.0943 | 0.2885 | 1.8 | 5csd:A, 5csd:B, 5csd:C, 5fb7:A, 5fb7:B, 5fb7:C, 5fb7:D, 3l1n:A |
7 | 7qen:A | 465 | 74 | 0.0610 | 0.0452 | 0.2838 | 2.3 | |
8 | 1vcl:A | 432 | 39 | 0.0407 | 0.0324 | 0.3590 | 3.5 | 1vcl:B, 3w9t:A, 3w9t:C, 3w9t:G, 3w9t:B, 3w9t:F, 3w9t:E, 3w9t:D, 2z48:A, 2z48:B, 2z49:A, 2z49:B |
9 | 4v8p:AH | 107 | 77 | 0.0523 | 0.1682 | 0.2338 | 4.5 | 4v8p:DH, 4v8p:FH, 4v8p:HH |
10 | 5yvm:A | 403 | 85 | 0.0669 | 0.0571 | 0.2706 | 4.9 | 5yvr:A, 5yvs:A |
11 | 6i9a:A | 453 | 102 | 0.0640 | 0.0486 | 0.2157 | 5.0 | 6i9a:B, 4rbm:A, 4tkx:L |
12 | 5olt:A | 383 | 51 | 0.0494 | 0.0444 | 0.3333 | 7.3 | 5ojh:A |
13 | 4gzk:A | 650 | 34 | 0.0378 | 0.0200 | 0.3824 | 8.3 | 4ieg:A, 4ieg:B, 4ieg:C, 4ieg:D |
14 | 8bbi:A | 335 | 31 | 0.0436 | 0.0448 | 0.4839 | 9.7 | 8bbi:B, 7nl2:A, 7nl2:B |