BioLiP

>protein
GSGFEGMFIRKGQWDCSVCCVQNESSSLKCVACDASKP

The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7mnv:B	38	38	1.0000	1.0000	1.0000	1.27e-22
2	7mnt:B	38	32	0.6053	0.6053	0.7188	3.21e-11	7mnt:D, 7mnu:B
3	7mns:B	38	32	0.5263	0.5263	0.6250	9.85e-09
4	7mo5:B	36	36	0.4474	0.4722	0.4722	8.56e-08
5	7mnr:B	40	31	0.5000	0.4750	0.6129	3.36e-07
6	7mo2:B	38	38	0.5000	0.5000	0.5000	7.89e-07	3ch5:B, 7mo2:D
7	2ebq:A	47	27	0.3947	0.3191	0.5556	1.26e-06	2gqe:A, 2k0c:A
8	7mo3:B	38	38	0.4737	0.4737	0.4737	3.05e-06	7mo3:D, 7mo4:B, 7mo4:D
9	2ebr:A	47	25	0.3684	0.2979	0.5600	5.19e-06
10	2ebv:A	57	37	0.5000	0.3333	0.5135	5.46e-06
11	7mnp:B	39	38	0.4474	0.4359	0.4474	7.72e-06	7mnp:D, 7mnq:B
12	2d9g:A	53	27	0.3421	0.2453	0.4815	1.28e-04
13	8pp6:K	36	26	0.3421	0.3611	0.5000	6.40e-04
14	7mo1:B	34	24	0.2895	0.3235	0.4583	0.011
15	7pcv:A	116	24	0.2895	0.0948	0.4583	0.039	2lk0:A, 2lk1:A, 7pcv:B, 7pdv:E, 7pdv:A, 7pdv:C, 7pdv:G
16	3a9j:C	32	26	0.1842	0.2188	0.2692	0.34	9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C
17	2d8v:A	67	17	0.2105	0.1194	0.4706	1.6
18	3icf:A	316	15	0.1842	0.0222	0.4667	3.8	3icf:B
19	2vqr:A	512	17	0.2105	0.0156	0.4706	4.0
20	6jk8:B	801	39	0.3158	0.0150	0.3077	4.6
21	6jk8:A	823	39	0.3158	0.0146	0.3077	5.9	1igr:A, 7v3p:B
22	8frl:G	338	34	0.2632	0.0296	0.2941	7.6	8frm:G, 8fro:G, 8ufg:G, 8ufh:G
23	2mxv:A	43	24	0.2632	0.2326	0.4167	8.0

[Back]