GSFNELNAINENIRDDLSALLKSDFFKYFRLDLYKQCSFWDANDGLCLNRACSVDWDTLPEYWQPEILGSFNNDTMKEAD
DSDDECKFLDQLANYCDVNDFNGKNAVLIDLTANPERFTGYGGKQAGQIWSTIYQDNCFTIGETGESLAKDAFYRLVSGF
HASIGTHLSKEYLNTKTGKWEPNLDLFMARIGNFPDRVTNMYFNYAVVAKALWKIQPYLPEFSFADLVNKEIKNKMDNVI
SQLDTKIFNEDLVFANDLSLTLKDEFRSRFKNVTKIMDCVQCDRCRLWGKIQTTGYATALKILFEINDADEFTKQHIVGK
LTKYELIALLQTFGRLSESIESVNMFEKMYGKRLLER
The query sequence (length=357) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1rp4:A | 374 | 374 | 0.9944 | 0.9492 | 0.9492 | 0.0 | 3m31:A, 1rq1:A |
2 | 3nvj:A | 351 | 358 | 0.9552 | 0.9715 | 0.9525 | 0.0 | |
3 | 3ahr:A | 362 | 356 | 0.3585 | 0.3536 | 0.3596 | 6.08e-59 | 3ahq:A |
4 | 3t9k:A | 281 | 60 | 0.0588 | 0.0747 | 0.3500 | 0.064 | 4f1p:A, 4f1p:B, 3jue:A, 3jue:B, 3t9k:B |
5 | 4n54:A | 340 | 129 | 0.0896 | 0.0941 | 0.2481 | 4.1 | 4n54:B, 4n54:C, 4n54:D |
6 | 6bk8:O | 229 | 100 | 0.0616 | 0.0961 | 0.2200 | 4.6 | |
7 | 4ls9:A | 319 | 78 | 0.0588 | 0.0658 | 0.2692 | 6.8 | 4ls9:B |
8 | 2huf:A | 385 | 94 | 0.0644 | 0.0597 | 0.2447 | 9.9 | 2huf:B, 2hui:A, 2hui:B, 2huu:A, 2huu:B |