BioLiP

>protein
GSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLIN
GGESAPTTLTQQT

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2mnu:A	93	93	1.0000	1.0000	1.0000	2.40e-61
2	4lxo:A	184	86	0.3333	0.1685	0.3605	9.29e-07	4lxo:B
3	4lxo:A	184	83	0.3118	0.1576	0.3494	3.17e-05	4lxo:B
4	3ch8:A	190	79	0.3011	0.1474	0.3544	2.47e-05	2qbw:A
5	5a43:C	96	77	0.3011	0.2917	0.3636	7.01e-05
6	8f0m:B	91	88	0.3118	0.3187	0.3295	2.87e-04
7	7l0f:H	94	75	0.2903	0.2872	0.3600	8.60e-04	7l0f:F, 7l0f:B, 7l0f:M, 7l0g:C, 7l0g:D, 7l0g:F, 7l0g:H
8	6x38:A	93	78	0.2688	0.2688	0.3205	0.001
9	6ux8:B	86	86	0.3011	0.3256	0.3256	0.002
10	6d0j:C	90	74	0.3118	0.3222	0.3919	0.002	6d0k:C, 6d0n:C
11	3csb:A	464	76	0.3118	0.0625	0.3816	0.006
12	5v7p:D	95	74	0.2903	0.2842	0.3649	0.017
13	6x39:A	100	90	0.2796	0.2600	0.2889	0.018
14	8vxu:E	90	75	0.2796	0.2889	0.3467	0.025	7szt:F, 8tgy:C, 8tgy:D, 6wk9:C, 6wk9:G
15	4jmh:A	200	89	0.2688	0.1250	0.2809	0.026	4jmg:A
16	5mtm:B	92	95	0.3333	0.3370	0.3263	0.11
17	8af0:A	123	28	0.1075	0.0813	0.3571	2.5	8af0:B, 9bdl:ANG, 9bdn:ANG, 9bdp:ANG, 5epz:A, 5eqo:A, 1h52:A, 1h53:A, 1hby:A, 7npm:AAA
18	2wl9:A	300	50	0.1828	0.0567	0.3400	4.1	2wl3:A, 2wl3:B, 2wl3:C, 2wl3:D, 2wl9:B, 2wl9:C, 2wl9:D
19	6q7i:A	770	53	0.1828	0.0221	0.3208	5.2	6q7j:A, 6q7j:B
20	2qdg:A	366	30	0.1183	0.0301	0.3667	6.6	2qap:A, 2qap:B, 2qap:C, 2qap:D, 2qdg:B, 2qdg:C, 2qdg:D, 2qdh:A, 2qdh:B, 2qdh:C, 2qdh:D

[Back]