GSDSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVS
KLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2k78:A | 126 | 123 | 0.9837 | 0.9603 | 0.9837 | 5.74e-86 | 2o6p:A, 2o6p:B |
2 | 4h8q:A | 119 | 119 | 0.2927 | 0.3025 | 0.3025 | 6.32e-13 | 4h8p:A |
3 | 3sik:A | 123 | 115 | 0.2927 | 0.2927 | 0.3130 | 1.78e-11 | 3sik:B |
4 | 4myp:A | 121 | 90 | 0.2195 | 0.2231 | 0.3000 | 7.48e-06 | 4myp:B |
5 | 3qzp:B | 125 | 119 | 0.2276 | 0.2240 | 0.2353 | 0.014 | 2itf:A, 2itf:B, 2itf:C, 2itf:D, 3qzl:A, 3qzm:A, 3qzm:B, 3qzn:A, 3qzn:B, 3qzn:C, 3qzo:A, 3qzo:C, 3qzo:B, 3qzo:D, 3qzp:A |
6 | 7pcf:F | 341 | 111 | 0.2683 | 0.0968 | 0.2973 | 0.090 | 7pch:E, 7pch:F, 3rtl:A, 3rtl:B, 3rtl:C, 3rtl:D, 3rur:A, 3rur:B, 3rur:C, 3rur:D, 5vmm:F, 5vmm:E |
7 | 7w81:A | 181 | 77 | 0.1545 | 0.1050 | 0.2468 | 4.0 | 3qug:A, 3qug:B, 3quh:A, 3quh:B, 3vtm:A, 3vtm:B, 7w81:B, 2z6f:A |
8 | 8om2:V | 286 | 45 | 0.0976 | 0.0420 | 0.2667 | 6.7 | 8d8j:V, 8d8k:V, 8d8l:V, 5mrc:VV, 5mre:VV, 5mrf:VV, 8om3:V, 8om4:V |
9 | 7sgx:D | 208 | 50 | 0.1138 | 0.0673 | 0.2800 | 6.8 | 7n4p:A, 7scm:A, 7scm:B, 7sgx:A, 7sgx:B, 7sgx:C |
10 | 7pgn:B | 438 | 17 | 0.0976 | 0.0274 | 0.7059 | 6.9 | 7pgm:B, 7pgn:A, 2wfx:B |