GSDAIEKAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTL
AGE
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7yrb:A | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 3.43e-59 | 5vmd:A, 5vmd:C, 5vmd:B, 5vmd:D |
2 | 8j9q:A | 73 | 58 | 0.2651 | 0.3014 | 0.3793 | 6.43e-10 | 8j9q:B, 8j9q:C, 8j9r:A |
3 | 8bja:B | 1638 | 44 | 0.1807 | 0.0092 | 0.3409 | 1.42e-05 | |
4 | 8bja:A | 1563 | 44 | 0.1807 | 0.0096 | 0.3409 | 1.53e-05 | |
5 | 8d4x:B | 1669 | 44 | 0.1807 | 0.0090 | 0.3409 | 1.53e-05 | 8c06:A, 8c06:D |
6 | 8e0q:A | 1689 | 44 | 0.1807 | 0.0089 | 0.3409 | 1.53e-05 | 8d4x:A, 8e0q:B |
7 | 8p82:A | 1596 | 44 | 0.1807 | 0.0094 | 0.3409 | 1.72e-05 | 8p82:B |
8 | 8ewi:A | 1775 | 44 | 0.1807 | 0.0085 | 0.3409 | 1.76e-05 | 8ewi:B, 8ewi:C, 8ewi:D |
9 | 7y70:A | 77 | 49 | 0.2410 | 0.2597 | 0.4082 | 0.010 | 6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A |
10 | 7mex:A | 1737 | 49 | 0.2169 | 0.0104 | 0.3673 | 0.011 | 6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A |
11 | 7wul:A | 70 | 45 | 0.2169 | 0.2571 | 0.4000 | 0.35 | 7wuk:A, 7wum:A, 7wun:A |
12 | 4xoq:A | 204 | 15 | 0.1205 | 0.0490 | 0.6667 | 1.4 | 4xoo:A, 4xoo:B, 4xoo:C, 4xoo:D, 4xoq:B, 4xoq:C, 4xoq:D |
13 | 6k15:H | 393 | 56 | 0.1928 | 0.0407 | 0.2857 | 1.6 | 6kw4:H, 6kw5:H, 6v8o:I, 6v92:I |
14 | 3sgz:A | 336 | 28 | 0.1205 | 0.0298 | 0.3571 | 9.7 | 3sgz:B, 3sgz:C, 1tb3:A, 1tb3:B, 1tb3:C, 1tb3:D, 1tb3:E, 1tb3:F, 1tb3:G, 1tb3:H |