GSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPATRKRWPNGVDQPAFFEKQLALSAPPWLSRATV
AHRSGTTTYPIIDSATGLAWIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLAEVARAVRDLLA
DIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVAQRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPY
SLRGRTHPTVAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDA
The query sequence (length=288) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2iry:A | 288 | 288 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2irx:A, 2iry:B, 4mky:B, 4mky:A, 4mky:C, 4mky:D, 3pky:A, 3pky:B, 2r9l:A, 2r9l:B |
2 | 6sa0:A | 333 | 261 | 0.2778 | 0.2402 | 0.3065 | 9.42e-28 | 6sa0:D, 6sa1:A, 6sa1:D |
3 | 2faq:A | 295 | 253 | 0.2500 | 0.2441 | 0.2846 | 5.59e-26 | 2faq:B, 2far:A, 2far:B |
4 | 2bru:B | 364 | 57 | 0.0625 | 0.0495 | 0.3158 | 3.7 | 1x14:B, 1x15:B |
5 | 1emd:A | 312 | 111 | 0.1111 | 0.1026 | 0.2883 | 6.1 | 1ib6:A, 1ib6:C, 1ib6:D, 1ie3:A, 1ie3:B, 1ie3:C, 1ie3:D, 5kka:A, 5kka:B |
6 | 6fp5:B | 86 | 24 | 0.0347 | 0.1163 | 0.4167 | 7.3 | 6fp5:A |
7 | 4cu7:A | 848 | 36 | 0.0521 | 0.0177 | 0.4167 | 9.9 | 4cu8:A, 4cuc:A |