GSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTFVMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGT
PEEKKLKIILEEMKEK
The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5c4v:B | 96 | 96 | 1.0000 | 1.0000 | 1.0000 | 2.18e-69 | 5c4v:D, 5c4v:F |
2 | 1mr1:C | 97 | 95 | 0.4896 | 0.4845 | 0.4947 | 1.17e-32 | 1mr1:D |
3 | 2fbh:A | 137 | 33 | 0.1042 | 0.0730 | 0.3030 | 0.39 | |
4 | 8qbh:A | 377 | 37 | 0.1250 | 0.0318 | 0.3243 | 0.52 | |
5 | 6a0k:A | 450 | 31 | 0.1042 | 0.0222 | 0.3226 | 1.3 | 6a0j:A, 6a0k:B, 6a0l:A, 5zxg:A |
6 | 6qfb:C | 1011 | 36 | 0.1250 | 0.0119 | 0.3333 | 2.2 | |
7 | 6kmw:aA | 721 | 38 | 0.1146 | 0.0153 | 0.2895 | 8.7 | 6kmw:bA, 6kmw:cA |