GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1fu9:A | 36 | 36 | 1.0000 | 1.0000 | 1.0000 | 1.18e-21 | 1jn7:A |
2 | 1fv5:A | 36 | 35 | 0.3056 | 0.3056 | 0.3143 | 0.074 | 2l6z:B, 1y0j:B |
3 | 2ena:A | 46 | 37 | 0.3333 | 0.2609 | 0.3243 | 0.20 | |
4 | 2emb:A | 44 | 32 | 0.3056 | 0.2500 | 0.3438 | 0.32 | |
5 | 7aih:Ay | 142 | 19 | 0.2500 | 0.0634 | 0.4737 | 0.54 | 7ane:Ay |
6 | 8j6n:A | 390 | 32 | 0.3611 | 0.0333 | 0.4062 | 0.70 | 8j6n:D, 8j6n:B, 8j6n:C, 8j6n:E, 8j6n:H, 8j6n:J, 8j6n:K, 8j6n:F, 8j6n:G, 8j6n:I, 8j6n:L |
7 | 2el6:A | 46 | 26 | 0.2500 | 0.1957 | 0.3462 | 0.94 | |
8 | 2emx:A | 44 | 26 | 0.2500 | 0.2045 | 0.3462 | 3.6 | |
9 | 7w02:A | 1566 | 31 | 0.2500 | 0.0057 | 0.2903 | 4.0 | |
10 | 2ep0:A | 46 | 26 | 0.2222 | 0.1739 | 0.3077 | 5.2 | |
11 | 2eml:A | 46 | 26 | 0.1944 | 0.1522 | 0.2692 | 5.4 | |
12 | 2em9:A | 46 | 26 | 0.2222 | 0.1739 | 0.3077 | 5.8 | |
13 | 2ytf:A | 46 | 26 | 0.2222 | 0.1739 | 0.3077 | 6.0 | 2eof:A |