BioLiP

>protein
GRQGKTLKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLK

The query sequence (length=65) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6qec:A	65	65	1.0000	1.0000	1.0000	1.14e-43	5lxu:A
2	8xas:C	63	57	0.5692	0.5873	0.6491	7.04e-24	8xas:B, 8xas:D, 8xas:A, 8xas:E, 8xas:F
3	6j5b:C	59	54	0.4308	0.4746	0.5185	8.39e-14	6j4r:A, 6j4r:D, 6j4r:B, 6j4r:C, 6j5b:A, 6j5b:D, 6j5b:F, 6j5b:H, 6j5b:J
4	7d3t:D	62	52	0.4308	0.4516	0.5385	3.79e-13	7d3t:A, 7d3t:B, 7d3t:C
5	5ahz:A	243	59	0.2462	0.0658	0.2712	0.040	5ahy:A, 1e12:A, 5g36:A, 2jaf:A, 2jag:A
6	3w81:A	616	52	0.2462	0.0260	0.3077	0.39	6i6r:A, 6i6r:B, 6i6x:A, 6i6x:B, 4kgj:B, 4kgj:A, 4kgl:B, 4kgl:A, 4kh2:B, 4kh2:A, 4obr:B, 4obr:A, 3w81:B, 3w82:A, 3w82:B
7	8xq7:A	1041	44	0.2769	0.0173	0.4091	0.57	8xq7:B
8	8pdv:A	1027	44	0.2769	0.0175	0.4091	0.74	8pd8:A, 8pd8:B, 8pd9:A, 8pdu:A, 8pdu:B
9	8otq:A	1051	44	0.2769	0.0171	0.4091	0.74	8otq:B, 8otw:B, 8xq8:A
10	8fkt:SY	378	53	0.2462	0.0423	0.3019	0.94	8fku:SY, 8fkv:SY, 8fkw:SY, 8fkx:SY, 8fky:SY
11	6ozj:B	250	47	0.2769	0.0720	0.3830	0.95	6ozj:A, 6ozk:A, 6ozk:B, 6ozl:A, 6ozl:B, 6ozm:A, 6ozm:B, 6ozn:A, 6ozn:B, 6ozo:A, 6ozo:B, 6ozp:A, 6ozp:B, 6ozq:A, 6ozq:B, 6ozr:A, 6ozr:B, 6ozs:A, 6ozs:B
12	5xbl:A	1320	55	0.2308	0.0114	0.2727	1.3
13	8k60:F	315	37	0.2000	0.0413	0.3514	3.2	8dy7:F, 8dy9:F, 8hvr:F, 8jke:F, 7vpd:F, 7vpz:F, 7x74:F, 7x75:F, 7x76:F
14	6euf:A	472	18	0.1077	0.0148	0.3889	3.9	6euf:B, 6euf:C, 6euf:D
15	5k1r:B	440	29	0.1538	0.0227	0.3448	5.7	5k1r:A
16	8cwr:B	109	37	0.1846	0.1101	0.3243	6.7	8cwt:B, 8cwt:D, 8cwt:F, 8cyf:B, 7kuf:B
17	7r89:B	529	52	0.2000	0.0246	0.2500	9.5
18	7r5s:T	112	32	0.1692	0.0982	0.3438	9.8

[Back]