GRPRMVDVTEKPETFRTATAEAFVELTEEALSALEKGGVGKGDPLVVAQLAGILAAKKTADLIPLCHPLPLTGVEVRVEL
LKAEKRVRIEATVKTKAETGVEMEAMTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRR
The query sequence (length=147) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3jqj:B | 149 | 147 | 1.0000 | 0.9866 | 1.0000 | 3.05e-102 | 3jqj:A, 3jqj:C, 3jqj:D, 3jqj:E, 3jqj:F, 3jqj:G, 3jqj:H, 3jqj:K, 3jqj:I, 3jqj:J, 3jqj:L, 3jqk:A, 3jqm:A, 3jqm:B, 3jqm:E, 3jqm:C, 3jqm:G, 3jqm:D, 3jqm:F, 3jqm:H, 3jqm:I |
2 | 4pyd:C | 154 | 146 | 0.5374 | 0.5130 | 0.5411 | 9.56e-47 | 4pya:A, 4pyd:A, 4pyd:B, 4pyd:E, 4pyd:D, 4pyd:F |
3 | 4ebk:A | 257 | 70 | 0.1565 | 0.0895 | 0.3286 | 2.4 | 4ebk:B |
4 | 8s9x:A | 770 | 32 | 0.0816 | 0.0156 | 0.3750 | 3.1 | 8s9t:A, 8s9u:A, 8s9v:A |
5 | 6ch7:Q | 231 | 45 | 0.1020 | 0.0649 | 0.3333 | 3.8 | 6ch8:Q, 6ch9:Q, 6dfg:H, 6dfg:G, 6dfg:I |
6 | 8cm5:A | 974 | 61 | 0.1361 | 0.0205 | 0.3279 | 6.5 | 8bqg:A, 8bqh:A, 8bqi:A, 8bqj:A, 8bqk:A, 8bql:A, 8cm4:A, 8cm4:C, 8cm5:C, 8cm5:K, 8cm5:R, 8cm6:A, 8cm6:C, 8cm7:A, 8rc8:A, 8rc9:A, 8rca:A, 8rcb:A, 8rcc:A, 8rcg:A, 6sdr:A, 6sdv:A, 7z5o:AAA |
7 | 7uuz:A | 501 | 51 | 0.1361 | 0.0399 | 0.3922 | 8.8 | 7uv0:A |