GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKK
The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1hcr:A | 52 | 49 | 1.0000 | 0.9423 | 1.0000 | 7.11e-31 | 1ijw:C, 1jj6:C, 1jj8:C, 1jko:C, 1jkp:C, 1jkq:C, 1jkr:C |
2 | 4m6f:A | 188 | 44 | 0.4694 | 0.1223 | 0.5227 | 4.10e-10 | |
3 | 6sup:A | 2128 | 28 | 0.2653 | 0.0061 | 0.4643 | 0.71 | |
4 | 5c6o:A | 446 | 37 | 0.2653 | 0.0291 | 0.3514 | 3.7 | |
5 | 3mzo:B | 211 | 31 | 0.1837 | 0.0427 | 0.2903 | 4.0 | 3mzo:A, 3mzo:C |
6 | 5fmp:A | 184 | 12 | 0.1633 | 0.0435 | 0.6667 | 4.5 | 5aqc:A, 5aqc:B, 5cw8:A, 5cw8:B, 5cxi:A, 5cxi:B, 5fmp:B, 5ua1:B, 5ua1:A, 5ua2:A |
7 | 4ip4:A | 421 | 20 | 0.1633 | 0.0190 | 0.4000 | 4.7 | 4ip4:B, 4ip5:A, 4ip5:B |
8 | 2wtz:B | 508 | 27 | 0.2041 | 0.0197 | 0.3704 | 5.5 | 2wtz:A, 2wtz:D, 2xja:A, 2xja:B, 2xja:C, 2xja:D |
9 | 4c0z:F | 209 | 32 | 0.2245 | 0.0526 | 0.3438 | 5.6 | 4c0z:A, 4c0z:B, 4c0z:C, 4c0z:D, 4c0z:E, 4c0z:G, 4c0z:H, 4c0z:I, 4c0z:J, 4c0z:K, 4c0z:L |
10 | 5kis:A | 1446 | 24 | 0.2245 | 0.0076 | 0.4583 | 5.7 | |
11 | 3bqk:A | 338 | 15 | 0.1633 | 0.0237 | 0.5333 | 6.0 | 3bql:A |