GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1hcr:A | 52 | 47 | 1.0000 | 0.9038 | 1.0000 | 1.68e-29 | 1ijw:C, 1jj6:C, 1jj8:C, 1jko:C, 1jkp:C, 1jkq:C, 1jkr:C |
| 2 | 4m6f:A | 188 | 44 | 0.4894 | 0.1223 | 0.5227 | 3.19e-10 | |
| 3 | 6sup:A | 2128 | 28 | 0.2766 | 0.0061 | 0.4643 | 0.69 | |
| 4 | 5fmp:A | 184 | 12 | 0.1702 | 0.0435 | 0.6667 | 4.1 | 5aqc:A, 5aqc:B, 5cw8:A, 5cw8:B, 5cxi:A, 5cxi:B, 5fmp:B, 5ua1:B, 5ua1:A, 5ua2:A |
| 5 | 4c0z:F | 209 | 32 | 0.2340 | 0.0526 | 0.3438 | 4.3 | 4c0z:A, 4c0z:B, 4c0z:C, 4c0z:D, 4c0z:E, 4c0z:G, 4c0z:H, 4c0z:I, 4c0z:J, 4c0z:K, 4c0z:L |
| 6 | 4ip4:A | 421 | 20 | 0.1702 | 0.0190 | 0.4000 | 4.3 | 4ip4:B, 4ip5:A, 4ip5:B |
| 7 | 3bqk:A | 338 | 15 | 0.1702 | 0.0237 | 0.5333 | 4.9 | 3bql:A |
| 8 | 5kis:A | 1446 | 24 | 0.2340 | 0.0076 | 0.4583 | 6.2 | |
| 9 | 2wtz:B | 508 | 27 | 0.2128 | 0.0197 | 0.3704 | 6.6 | 2wtz:A, 2wtz:D, 2xja:A, 2xja:B, 2xja:C, 2xja:D |
| 10 | 5c6o:A | 446 | 34 | 0.2766 | 0.0291 | 0.3824 | 6.9 | |
| 11 | 4gcl:B | 196 | 21 | 0.1702 | 0.0408 | 0.3810 | 8.6 | 4gck:A, 4gck:B, 4gck:C, 4gck:D, 4gcl:A, 4gcl:C, 4gcl:D, 4gcl:E, 4gcl:G, 4gcl:H, 4gcl:F, 5hbu:A, 5hbu:B, 5hbu:C, 5hbu:D, 5hbu:E, 5hbu:G, 5hbu:H, 5hbu:F, 5hsz:A, 5k58:E, 5k58:F, 5k58:A, 5k58:B |
| 12 | 7p5h:C | 156 | 37 | 0.2553 | 0.0769 | 0.3243 | 8.8 | 7p5h:F, 7p5h:c, 7p5h:f, 7p8n:c, 7p8n:C, 7p91:c, 7p91:C, 7p92:C |
umich.edu