GRKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLN
DQANTLVDLAKTQLEHH
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4j9z:B | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 4.29e-66 | 6ale:B, 4g27:B, 5v02:B, 5v03:B, 5wbx:B, 5wc5:B |
2 | 2x7f:A | 276 | 79 | 0.2371 | 0.0833 | 0.2911 | 0.19 | 5ax9:B, 2x7f:D, 2x7f:E |
3 | 6ra7:A | 302 | 79 | 0.2371 | 0.0762 | 0.2911 | 0.21 | 5ax9:A, 5ax9:C, 5d7a:A, 5d7a:B, 5d7a:C, 5di1:A, 5j95:A, 4obp:A, 6ra5:A, 4rvt:A, 4u40:A, 4u42:A, 4u43:A, 4u44:A, 4u45:A, 5w5q:A, 8wm0:A, 2x7f:B, 2x7f:C, 7xzq:A, 7xzr:A, 7xzr:B, 4zk5:A, 4zp5:A |
4 | 4obo:A | 275 | 40 | 0.1237 | 0.0436 | 0.3000 | 0.23 | 4obq:A, 4u41:A, 4u42:B |
5 | 8pmq:9 | 412 | 62 | 0.1753 | 0.0413 | 0.2742 | 4.6 | |
6 | 7vnr:A | 333 | 37 | 0.1031 | 0.0300 | 0.2703 | 9.4 | 7vnr:C, 7vnr:E, 7vnr:G |