BioLiP

>protein
GRKLELTKAEKHFHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLN
DQANTLVDLAKTQLE

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4j9z:B	97	95	0.9895	0.9691	0.9895	1.30e-63	6ale:B, 4g27:B, 5v02:B, 5v03:B, 5wbx:B, 5wc5:B
2	4obo:A	275	77	0.2105	0.0727	0.2597	0.24	4obq:A, 4u41:A, 4u42:B
3	2x7f:A	276	76	0.2316	0.0797	0.2895	0.25	5ax9:B, 2x7f:D, 2x7f:E
4	6ra7:A	302	76	0.2316	0.0728	0.2895	0.27	5ax9:A, 5ax9:C, 5d7a:A, 5d7a:B, 5d7a:C, 5di1:A, 5j95:A, 4obp:A, 6ra5:A, 4rvt:A, 4u40:A, 4u42:A, 4u43:A, 4u44:A, 4u45:A, 5w5q:A, 8wm0:A, 2x7f:B, 2x7f:C, 7xzq:A, 7xzr:A, 7xzr:B, 4zk5:A, 4zp5:A
5	6n20:D	501	56	0.1579	0.0299	0.2679	1.3	6b86:A, 6b86:B, 6b86:C, 6b86:D, 8fu2:A, 8fu2:B, 8fu2:C, 8fu2:D, 8fu5:A, 8fu5:B, 8fu5:C, 8fu5:D, 6n1y:A, 6n1y:B, 6n1y:C, 6n1y:D, 6n20:A, 6n20:C, 6n20:B, 6n21:A, 6n21:B, 6n21:C, 6n21:D, 8srl:A, 8srl:B, 8srl:C, 8srl:D, 7t8p:A, 7t8p:B, 7t8p:C, 7t8p:D, 7t8q:A, 7t8q:B, 7t8q:C, 7t8q:D, 5u8x:A, 5u8x:B, 5u8x:C, 5u8x:D, 5u8y:A, 5u8y:B, 5u8y:C, 5u8y:D, 5u8z:A, 5u8z:B, 5u8z:C, 5u8z:D, 5u90:A, 5u90:B, 5u90:C, 5u90:D, 5u97:A, 5u97:B, 5u97:C, 5u97:D
6	7vnr:A	333	64	0.1579	0.0450	0.2344	5.3	7vnr:C, 7vnr:E, 7vnr:G
7	7mqa:NB	103	81	0.2526	0.2330	0.2963	8.8	7mq8:NB, 7mq9:NB

[Back]