GRFDQVGGAFGWKPHKLDPKECAQVAYDGYWYKGFGCGFGAFYSIVGLMGEKYGAPYNQFPFAMLEANKGGISDWGTICG
ALYGAAATFSLFWGRKEVHPMVNELFRWYEVTKLPIFNPGDAAQGVKGDLPMSASDSVLCHISVSKWCYENKIEATSKQR
SERCGRLTADAAFKAAEIINTKIDQGKDFKSTFPMQASVSSCGECHMTKGNDANWAKGIMDCTPCHSGTAATQNKFVNHP
The query sequence (length=240) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1h21:A | 240 | 240 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1h21:B, 1h21:C, 1h21:D |
2 | 5fea:A | 125 | 40 | 0.0583 | 0.1120 | 0.3500 | 2.4 | 5fea:B |
3 | 8i3q:A | 595 | 47 | 0.0583 | 0.0235 | 0.2979 | 2.5 | |
4 | 6xmg:A | 638 | 47 | 0.0583 | 0.0219 | 0.2979 | 3.0 | 6xmf:A |
5 | 7am2:BK | 694 | 53 | 0.0542 | 0.0187 | 0.2453 | 6.5 | |
6 | 3wr9:A | 416 | 66 | 0.0750 | 0.0433 | 0.2727 | 6.8 | 3wku:A, 3wku:B, 3wpm:A, 3wpm:B, 3wr3:A, 3wr3:B, 3wr4:A, 3wr4:B, 3wr8:A, 3wr8:B, 3wr9:B, 3wra:A, 3wra:B, 3wrb:A, 3wrb:B, 3wrc:A, 3wrc:B |