GQSGSVRAIMVSSIGACLFASRFGLAPSVRKNATAAGTDLEKSVHAAGDDPGAGFTATDVLAMGAAGHAIGVGEWLAQLA
RGGV
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sl5:K | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 3.96e-55 | |
2 | 6igz:K | 80 | 68 | 0.4405 | 0.4625 | 0.5441 | 5.63e-16 | |
3 | 7dz7:K | 86 | 75 | 0.5238 | 0.5116 | 0.5867 | 9.80e-15 | 7bgi:K, 7blx:K, 7d0j:K, 7dz8:K, 6ijj:K, 6ijo:K, 7r3k:K, 7zq9:K, 7zqc:K, 7zqd:K, 7zqd:K2 |
4 | 8htu:K | 81 | 72 | 0.4405 | 0.4568 | 0.5139 | 6.51e-14 | 7ksq:K, 7kux:K, 6l35:K, 7xqp:K |
5 | 8wgh:K | 83 | 70 | 0.4524 | 0.4578 | 0.5429 | 1.92e-12 | |
6 | 8j6z:K | 84 | 73 | 0.4524 | 0.4524 | 0.5205 | 1.25e-11 | 7dkz:K, 8j7b:K, 5l8r:K, 4rku:K, 6yac:K, 6yez:K, 6zoo:K, 6zxs:K |
7 | 7a4p:K | 86 | 75 | 0.4048 | 0.3953 | 0.4533 | 1.59e-11 | 6zzx:K, 6zzy:K |
8 | 8bcv:K | 88 | 72 | 0.3929 | 0.3750 | 0.4583 | 4.16e-11 | 7ew6:K, 7ewk:K, 7f9o:K, 7f9o:n, 2wse:K, 5zji:K |
9 | 8cmo:K | 89 | 83 | 0.4405 | 0.4157 | 0.4458 | 1.36e-10 | |
10 | 7wfd:AK | 65 | 72 | 0.3690 | 0.4769 | 0.4306 | 4.49e-08 | 7wfe:BK, 7wg5:AK, 7wg5:BK |
11 | 6l35:G | 98 | 74 | 0.3690 | 0.3163 | 0.4189 | 9.77e-07 | 8htu:G, 7ksq:G, 7kux:G, 7xqp:G |
12 | 7yca:K | 87 | 73 | 0.3452 | 0.3333 | 0.3973 | 4.31e-06 | |
13 | 4y28:K | 57 | 72 | 0.3214 | 0.4737 | 0.3750 | 3.01e-05 | |
14 | 8j7a:K | 56 | 72 | 0.3333 | 0.5000 | 0.3889 | 2.11e-04 | |
15 | 7yca:G | 95 | 81 | 0.3214 | 0.2842 | 0.3333 | 0.001 | |
16 | 4xk8:k | 46 | 24 | 0.1786 | 0.3261 | 0.6250 | 0.032 | 4xk8:K |
17 | 8cmo:G | 93 | 32 | 0.1905 | 0.1720 | 0.5000 | 0.036 | |
18 | 7wg5:AG | 99 | 78 | 0.2976 | 0.2525 | 0.3205 | 0.047 | 7dkz:G, 8j6z:G, 8j7a:G, 8j7b:G, 5l8r:G, 7wfd:AG, 7wfe:BG, 7wg5:BG, 6yac:G, 6yez:G, 6zoo:G, 6zxs:G |
19 | 7zqc:G | 80 | 66 | 0.2976 | 0.3125 | 0.3788 | 0.049 | 7bgi:G, 7blx:G, 6jo5:G, 6jo6:G |
20 | 5ve8:B | 1030 | 26 | 0.1548 | 0.0126 | 0.5000 | 0.054 | 5ve8:A, 5w0v:A, 5w0v:B |
21 | 6jo5:K | 45 | 19 | 0.1667 | 0.3111 | 0.7368 | 0.089 | 8h2u:K, 6jo6:K |
22 | 7a4p:G | 99 | 29 | 0.1905 | 0.1616 | 0.5517 | 0.22 | 6zzx:G, 6zzy:G |
23 | 7zq9:G | 95 | 34 | 0.2143 | 0.1895 | 0.5294 | 0.22 | 7d0j:G, 7dz7:G, 7dz8:G, 8h2u:G, 7zqd:G, 7zqd:G2 |
24 | 3lw5:G | 95 | 78 | 0.2976 | 0.2632 | 0.3205 | 0.36 | 6igz:G, 2o01:G, 2wsc:G, 2wse:G, 2wsf:G, 4xk8:G, 4xk8:g |
25 | 6ijo:G | 70 | 31 | 0.1786 | 0.2143 | 0.4839 | 0.43 | 7r3k:G |
26 | 5zji:G | 97 | 78 | 0.2976 | 0.2577 | 0.3205 | 0.63 | |
27 | 2y4e:A | 384 | 49 | 0.2143 | 0.0469 | 0.3673 | 1.1 | 3o72:A, 3o72:B, 3o72:C, 3o72:D, 2y4e:B, 2y4f:A, 2y4f:B |
28 | 8wgh:G | 98 | 72 | 0.2619 | 0.2245 | 0.3056 | 1.3 | |
29 | 8bcv:G | 94 | 22 | 0.1310 | 0.1170 | 0.5000 | 4.1 | |
30 | 7opy:F | 217 | 28 | 0.1190 | 0.0461 | 0.3571 | 6.6 | 7opy:A, 7opy:B, 7opy:C, 7opz:C, 7opz:A, 7opz:B, 7opz:D |
31 | 6zj3:SP | 141 | 48 | 0.1667 | 0.0993 | 0.2917 | 6.8 | |
32 | 8pvs:A | 731 | 22 | 0.1310 | 0.0150 | 0.5000 | 7.2 | 8pvs:B |
33 | 6ob6:B | 357 | 31 | 0.1429 | 0.0336 | 0.3871 | 8.9 | |
34 | 8tzi:A | 385 | 31 | 0.1429 | 0.0312 | 0.3871 | 9.3 | 6ob6:A, 6ob7:A |