GQCLYKISSYTSYPMHDFYRCHTCNRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTL
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7yrb:A | 83 | 69 | 1.0000 | 0.7952 | 0.9565 | 3.10e-44 | 5vmd:A, 5vmd:C, 5vmd:B, 5vmd:D |
2 | 8j9q:A | 73 | 58 | 0.3182 | 0.2877 | 0.3621 | 3.51e-07 | 8j9q:B, 8j9q:C, 8j9r:A |
3 | 8bja:B | 1638 | 44 | 0.2273 | 0.0092 | 0.3409 | 5.22e-04 | |
4 | 8e0q:A | 1689 | 44 | 0.2273 | 0.0089 | 0.3409 | 5.76e-04 | 8d4x:A, 8e0q:B |
5 | 8ewi:A | 1775 | 44 | 0.2273 | 0.0085 | 0.3409 | 5.77e-04 | 8ewi:B, 8ewi:C, 8ewi:D |
6 | 8d4x:B | 1669 | 44 | 0.2273 | 0.0090 | 0.3409 | 5.99e-04 | 8c06:A, 8c06:D |
7 | 8bja:A | 1563 | 44 | 0.2273 | 0.0096 | 0.3409 | 6.42e-04 | |
8 | 8p82:A | 1596 | 44 | 0.2273 | 0.0094 | 0.3409 | 6.42e-04 | 8p82:B |
9 | 7y70:A | 77 | 49 | 0.3030 | 0.2597 | 0.4082 | 0.058 | 6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A |
10 | 7mex:A | 1737 | 49 | 0.2879 | 0.0109 | 0.3878 | 0.11 | 6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A |
11 | 7wul:A | 70 | 45 | 0.2727 | 0.2571 | 0.4000 | 1.2 | 7wuk:A, 7wum:A, 7wun:A |
12 | 6k15:H | 393 | 56 | 0.2424 | 0.0407 | 0.2857 | 1.3 | 6kw4:H, 6kw5:H, 6v8o:I, 6v92:I |
13 | 7rjt:A | 902 | 20 | 0.1515 | 0.0111 | 0.5000 | 5.2 | 7rjt:B, 7rjt:C, 7rjt:D, 7rk6:A, 7rk6:B, 7rk6:C, 7rk6:D, 5tj6:A |
14 | 3zc0:B | 191 | 40 | 0.1515 | 0.0524 | 0.2500 | 6.6 | 3zc0:A, 3zc0:E, 3zc0:F, 3zc0:I, 3zc0:C, 3zc0:D, 3zc0:G, 3zc0:H, 3zc0:J, 3zc0:K, 3zc0:L, 3zc1:B, 3zc1:C, 3zc1:D, 3zc1:F, 3zc1:G |
15 | 8ibt:A | 694 | 13 | 0.1061 | 0.0101 | 0.5385 | 6.9 | 8ibs:A, 8ibs:B, 8ibs:C, 8ibs:D, 8ibs:E, 8ibs:F, 8ibt:B |