GQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESL
VTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFK
The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3j1o:J | 159 | 142 | 0.9861 | 0.8931 | 1.0000 | 1.55e-102 | 3rj1:J, 3rj1:Q, 7ui9:h, 7uif:h, 7uig:h, 7uio:Ah, 7uio:Bh |
2 | 5iji:A | 227 | 55 | 0.1250 | 0.0793 | 0.3273 | 0.11 | 5jef:A, 5jef:B, 5jgp:A |
3 | 7ns4:i | 358 | 121 | 0.1736 | 0.0698 | 0.2066 | 1.3 | |
4 | 5fjm:A | 447 | 66 | 0.1319 | 0.0425 | 0.2879 | 1.7 | 5fjm:B, 5fjn:A, 5fjn:B |
5 | 7ajt:UR | 482 | 57 | 0.1111 | 0.0332 | 0.2807 | 2.1 | 7aju:UR, 7d4i:B8, 7d5s:B8, 7d5t:B8, 7d63:B8, 6ke6:B8, 6lqp:B8, 6lqq:B8, 6lqr:B8, 6lqs:B8, 6lqt:B8, 6lqu:B8, 6lqv:B8, 6nd4:S, 7suk:LS, 5wlc:LS, 6zqa:UR, 6zqb:UR, 6zqc:UR, 6zqd:UR |
6 | 4g6u:A | 213 | 55 | 0.1042 | 0.0704 | 0.2727 | 2.6 | |
7 | 3dnf:B | 282 | 65 | 0.1319 | 0.0674 | 0.2923 | 3.6 | 3dnf:A |
8 | 5ccv:A | 849 | 75 | 0.1667 | 0.0283 | 0.3200 | 4.7 | 6h80:A, 6h9r:A, 6izz:A |
9 | 3w9z:A | 290 | 88 | 0.1111 | 0.0552 | 0.1818 | 5.6 | |
10 | 6zu5:SBB | 80 | 33 | 0.0972 | 0.1750 | 0.4242 | 6.1 | |
11 | 7d6v:A | 601 | 58 | 0.1250 | 0.0300 | 0.3103 | 6.3 | 7d6x:A |
12 | 2exr:A | 491 | 117 | 0.2153 | 0.0631 | 0.2650 | 8.4 | 2q4w:A |
13 | 7bzc:A | 535 | 92 | 0.1528 | 0.0411 | 0.2391 | 8.7 | 7bzb:A |