GPVALHNVAPGTASTDAVNVGQLGAVTTGLGGGAAIDPKTGAVTAPSYTVYNADGTTSNVGNVGAAIDAINSTGIKYFHA
NSTKPDSQALGADSVAIGPNAVANNAGDVALGSGAVTSQAGGTLSETINGVTYSFAGTTPIGTVSVGAPGVERTITNVAA
GRIGQSSTDAINGSQLYGTNQSIEALTDKMNSLGNTVANTLASYNPQTGAV
The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4usx:C | 214 | 212 | 0.9905 | 0.9766 | 0.9858 | 5.86e-141 | 4usx:A, 4usx:B |
2 | 6qp4:A | 157 | 63 | 0.1327 | 0.1783 | 0.4444 | 1.74e-07 | |
3 | 3s6l:D | 158 | 99 | 0.1659 | 0.2215 | 0.3535 | 0.004 | 3s6l:A, 3s6l:B, 3s6l:C, 3s6l:E |
4 | 4n4r:C | 533 | 65 | 0.1043 | 0.0413 | 0.3385 | 7.7 | 4n4r:A |
5 | 4xeq:B | 304 | 81 | 0.1090 | 0.0757 | 0.2840 | 8.0 | 4xeq:A, 4xeq:C, 4xeq:D |