GPMERTFSEALKNRRTYYSITDQSPIPDQEIECIINLAVRHVPSAFNSQSTRVVLLLGKSHKKLWNIVKDALRKIVPGEA
FAKTEEKIDNSFACGYGTVLFFEDQKVVKGLQEAFPSYQENFPGWSLQTSAMHQLAVWVMLEDVGFGASLQHYNPLIDDE
VRRAWNLPAHWHLIAEMPFGVPVNKPGEKEFQPLEERIKVFK
The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8cqv:A | 202 | 202 | 1.0000 | 1.0000 | 1.0000 | 2.77e-153 | 8cqv:B |
2 | 1ywq:A | 199 | 195 | 0.4455 | 0.4523 | 0.4615 | 1.22e-61 | |
3 | 2ifa:B | 201 | 197 | 0.4158 | 0.4179 | 0.4264 | 1.94e-54 | 2ifa:A, 2ifa:C, 2ifa:D, 2ifa:E, 2ifa:F |
4 | 4bn9:A | 191 | 198 | 0.4307 | 0.4555 | 0.4394 | 7.75e-49 | 4bn6:A, 4bn7:A, 4bn8:A, 4bnb:A, 2wqf:A |
5 | 1zch:A | 249 | 55 | 0.0891 | 0.0723 | 0.3273 | 0.16 | |
6 | 3bem:B | 210 | 74 | 0.0990 | 0.0952 | 0.2703 | 0.71 | 3bem:A |
7 | 8dqd:A | 370 | 68 | 0.1040 | 0.0568 | 0.3088 | 1.3 | 8dvw:A, 8dvz:A |
8 | 3kwk:A | 168 | 68 | 0.1040 | 0.1250 | 0.3088 | 2.8 | |
9 | 8cqt:B | 164 | 192 | 0.2030 | 0.2500 | 0.2135 | 4.1 | 8cqt:A |
10 | 2hdc:A | 97 | 31 | 0.0545 | 0.1134 | 0.3548 | 4.2 | |
11 | 3qo8:A | 441 | 50 | 0.0693 | 0.0317 | 0.2800 | 4.5 | 3qo7:A |
12 | 3m5k:A | 168 | 64 | 0.0990 | 0.1190 | 0.3125 | 6.8 | 3m5k:B |
13 | 8avk:A | 202 | 46 | 0.0594 | 0.0594 | 0.2609 | 7.6 | 8avk:B, 8avn:A, 8avn:B |
14 | 4x6r:B | 290 | 32 | 0.0545 | 0.0379 | 0.3438 | 8.0 | 3fhi:B, 4jv4:A, 5kjx:A, 5kjy:A, 5kjz:A, 7lz4:A, 7lz4:B, 7lz4:C, 7lz4:D, 7lz4:E, 7lz4:F, 7lz4:G, 7lz4:H, 4mx3:A, 4mx3:B, 1ne4:A, 1ne6:A, 3plq:A, 3pna:A, 3pna:B, 1rgs:A, 1rl3:A, 1rl3:B |