BioLiP

>protein
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPI
HFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIAT
PKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPA

The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3rpn:A	220	220	1.0000	1.0000	1.0000	1.50e-165	3rpn:B, 3rpn:C, 3rpn:F, 3rpn:D, 3rpn:E, 1yzx:A, 1yzx:B
2	1r4w:A	221	220	0.6909	0.6878	0.6909	7.80e-119	1r4w:B, 1r4w:C, 1r4w:D
3	3fz5:C	192	151	0.1636	0.1875	0.2384	2.70e-04	3fz5:A, 3fz5:B
4	2imd:A	203	208	0.2045	0.2217	0.2163	0.013	2ime:A, 2imf:A
5	1q2l:A	937	114	0.1364	0.0320	0.2632	0.14
6	1cz7:D	365	35	0.0636	0.0384	0.4000	0.86	1cz7:A, 1cz7:B, 1cz7:C, 3l1c:A, 1n6m:A, 2ncd:A, 3u06:A, 5w3d:A
7	3u06:B	344	35	0.0636	0.0407	0.4000	1.1	3l1c:B, 1n6m:B
8	3ex7:I	62	22	0.0455	0.1613	0.4545	2.2	2xb2:T, 2xb2:S
9	2vg8:A	465	29	0.0591	0.0280	0.4483	4.1	2vce:A, 2vch:A
10	8fmw:U	69	51	0.0727	0.2319	0.3137	6.0
11	4usz:A	415	39	0.0636	0.0337	0.3590	6.1	4cit:A
12	1aoz:A	552	80	0.0909	0.0362	0.2500	7.8	1aoz:B, 1aso:A, 1aso:B, 1asp:A, 1asp:B, 1asq:A, 1asq:B
13	3ww1:A	242	39	0.0636	0.0579	0.3590	7.8	3ww1:B, 3ww2:A, 3ww2:B, 3ww3:A, 3ww3:B, 3ww4:A, 3ww4:B

[Back]