BioLiP

>protein
GPLGSVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYR

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2fc7:A	82	61	0.9375	0.7317	0.9836	4.24e-41	6e83:B, 6e86:B
2	6ww4:B	56	55	0.2969	0.3393	0.3455	3.04e-04	6ww4:A
3	6ww3:A	60	55	0.2969	0.3167	0.3455	5.25e-04	6ww3:B
4	4xi6:A	363	58	0.2969	0.0523	0.3276	0.002	4xi7:A, 4xib:A
5	2dip:A	98	39	0.2031	0.1327	0.3333	0.56
6	2e5r:A	63	51	0.2188	0.2222	0.2745	0.71
7	5d6s:A	370	41	0.2656	0.0459	0.4146	1.9	5d6s:B, 5d6s:C, 5d6s:D, 5d6s:E
8	3ir9:A	162	47	0.2344	0.0926	0.3191	3.2	3ir9:B
9	1ici:A	256	24	0.1562	0.0391	0.4167	4.6	1ici:B, 1m2g:A, 1m2h:A, 1m2j:A, 1m2k:A, 1m2n:A, 1m2n:B, 4twi:A
10	8im5:A	66	16	0.1406	0.1364	0.5625	4.8	3b0a:E
11	6miu:A	57	42	0.2500	0.2807	0.3810	5.9	6khz:C, 6khz:D, 6miu:B, 6mj7:A, 7r1o:BBB, 7r1o:DDD, 7r1o:AAA, 7r1o:CCC, 5yp7:A, 5yp7:D, 5yp8:A, 5yp8:B, 5ypa:A, 5ypa:B, 5ypb:C, 5ypb:D, 5ype:C, 5ype:D, 5ypf:C, 5ypf:D, 5ypg:A, 5ypg:B, 5yph:A
12	8gzh:D	615	28	0.1719	0.0179	0.3929	6.6	8gzg:D
13	8syi:D	620	28	0.1719	0.0177	0.3929	6.6	8urw:D
14	8h40:E	620	28	0.1719	0.0177	0.3929	6.6
15	6beh:B	544	30	0.1875	0.0221	0.4000	6.7	6beb:A, 6bec:A, 6bec:B, 6bec:C, 6bed:A, 6bed:C, 6bee:A, 6bee:C, 6bef:A, 6bef:C, 6beh:A, 6beh:C
16	6x67:C	478	33	0.1562	0.0209	0.3030	7.4	5lme:A, 6x67:D, 6x68:C, 6x68:D

[Back]