BioLiP

>protein
GPLGSGQCLYKISSYTSYPMHDFYRCHTCNTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTL

The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yrb:A	83	73	0.9315	0.8193	0.9315	3.36e-46	5vmd:A, 5vmd:C, 5vmd:B, 5vmd:D
2	8j9q:A	73	58	0.3014	0.3014	0.3793	3.36e-08	8j9q:B, 8j9q:C, 8j9r:A
3	8bja:B	1638	44	0.2055	0.0092	0.3409	3.01e-04
4	8bja:A	1563	44	0.2055	0.0096	0.3409	3.45e-04
5	8e0q:A	1689	44	0.2055	0.0089	0.3409	3.46e-04	8d4x:A, 8e0q:B
6	8d4x:B	1669	44	0.2055	0.0090	0.3409	3.74e-04	8c06:A, 8c06:D
7	8p82:A	1596	44	0.2055	0.0094	0.3409	3.85e-04	8p82:B
8	8ewi:A	1775	44	0.2055	0.0085	0.3409	3.86e-04	8ewi:B, 8ewi:C, 8ewi:D
9	7y70:A	77	49	0.2877	0.2727	0.4286	0.018	6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A
10	7mex:A	1737	49	0.2466	0.0104	0.3673	0.081	6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A
11	7wul:A	70	45	0.2603	0.2714	0.4222	0.69	7wuk:A, 7wum:A, 7wun:A
12	5y6q:A	157	45	0.2055	0.0955	0.3333	1.9
13	6k15:H	393	56	0.2055	0.0382	0.2679	3.3	6kw4:H, 6kw5:H, 6v8o:I, 6v92:I
14	2csv:A	72	48	0.2055	0.2083	0.3125	6.1
15	7bvh:A	1035	25	0.1507	0.0106	0.4400	6.4	7bve:A, 7bve:B, 7bvh:B
16	6nz4:A	467	37	0.1233	0.0193	0.2432	7.6	6nz4:B, 6nz5:B, 6nz6:A, 6nz6:B
17	8ibt:A	694	13	0.0959	0.0101	0.5385	8.8	8ibs:A, 8ibs:B, 8ibs:C, 8ibs:D, 8ibs:E, 8ibs:F, 8ibt:B

[Back]