BioLiP

>protein
GPLGSGQCLYKISSYTSYPMHDFYRCHTCNDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTL

The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7yrb:A	83	73	0.9306	0.8072	0.9178	2.46e-45	5vmd:A, 5vmd:C, 5vmd:B, 5vmd:D
2	8j9q:A	73	58	0.3056	0.3014	0.3793	4.90e-08	8j9q:B, 8j9q:C, 8j9r:A
3	8bja:B	1638	44	0.2083	0.0092	0.3409	1.97e-04
4	8bja:A	1563	44	0.2083	0.0096	0.3409	2.29e-04
5	8e0q:A	1689	44	0.2083	0.0089	0.3409	2.29e-04	8d4x:A, 8e0q:B
6	8d4x:B	1669	44	0.2083	0.0090	0.3409	2.31e-04	8c06:A, 8c06:D
7	8p82:A	1596	44	0.2083	0.0094	0.3409	2.55e-04	8p82:B
8	8ewi:A	1775	44	0.2083	0.0085	0.3409	2.55e-04	8ewi:B, 8ewi:C, 8ewi:D
9	7y70:A	77	49	0.2778	0.2597	0.4082	0.17	6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A
10	6k15:H	393	56	0.2083	0.0382	0.2679	2.8	6kw4:H, 6kw5:H, 6v8o:I, 6v92:I
11	7bvh:A	1035	25	0.1528	0.0106	0.4400	6.2	7bve:A, 7bve:B, 7bvh:B
12	7wul:A	70	45	0.2500	0.2571	0.4000	8.0	7wuk:A, 7wum:A, 7wun:A
13	8ibt:A	694	13	0.0972	0.0101	0.5385	8.5	8ibs:A, 8ibs:B, 8ibs:C, 8ibs:D, 8ibs:E, 8ibs:F, 8ibt:B

[Back]