GPLGSEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVLPEKK
The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2lhn:A | 80 | 80 | 1.0000 | 1.0000 | 1.0000 | 7.44e-56 | 5l2l:A, 5l2l:B, 5l2l:F, 5l2l:E |
2 | 4lj0:A | 65 | 65 | 0.2750 | 0.3385 | 0.3385 | 0.002 | 4lj0:B |
3 | 3zj2:A | 71 | 28 | 0.1500 | 0.1690 | 0.4286 | 0.41 | |
4 | 6bme:A | 127 | 49 | 0.1875 | 0.1181 | 0.3061 | 3.1 | 6bme:B |
5 | 3iar:A | 360 | 28 | 0.1500 | 0.0333 | 0.4286 | 4.3 | 2bgn:E, 2bgn:F, 2bgn:G, 2bgn:H, 2e1w:A, 1krm:A, 1ndv:A, 1ndw:A, 1ndy:A, 1ndz:A, 1o5r:A, 1qxl:A, 7rtg:A, 7rtg:B, 1uml:A, 1v79:A, 1v7a:A, 1vfl:A, 1w1i:E, 1w1i:F, 1w1i:G, 1w1i:H, 1wxy:A, 1wxz:A, 2z7g:A |
6 | 5xrs:G | 321 | 19 | 0.1250 | 0.0312 | 0.5263 | 6.0 | 5xrs:A, 5xrs:C |
7 | 4uny:C | 330 | 22 | 0.1125 | 0.0273 | 0.4091 | 9.0 | 4unx:A, 4unx:C, 4unx:E, 4uny:A, 4uny:E, 4unz:A, 4unz:C, 4unz:E, 4uo1:A, 4uo1:C, 4uo1:E, 4uo2:A, 4uo2:C, 4uo2:E, 4uo5:A, 4uo5:C, 4uo5:E, 4uo6:A, 4uo7:A, 4uo7:C, 4uo7:E, 4uo8:A |