GPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEA
The query sequence (length=95) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6fyx:i |
121 |
95 |
1.0000 |
0.7851 |
1.0000 |
4.93e-68 |
8cah:i, 8cas:A, 6fyy:i, 6gsm:i, 6gsn:i, 3j80:i, 3j81:i, 3jam:i, 3jap:i, 8rw1:i, 8s8d:i, 8s8e:i, 8s8f:i, 8s8g:i, 8s8h:i, 8s8i:i, 8s8j:i, 4uer:0, 6zce:i, 6zu9:A |
2 |
1d7q:A |
143 |
93 |
0.7053 |
0.4685 |
0.7204 |
1.15e-45 |
7a09:G, 4kzy:n, 4kzz:n, 8oz0:G, 8p03:j, 8p09:j, 8pj1:q, 8pj2:q, 8pj3:q, 8pj4:q, 8pj5:q, 8pj6:q, 8ppl:Iq, 7qp6:q, 7qp7:q, 7syq:A, 7syr:A, 7sys:A, 7syv:A, 7syw:A, 7syx:A, 7tql:4, 6yal:j, 6yam:j, 6ybw:q, 6zmw:q, 6zp4:G |
3 |
4bts:A0 |
99 |
94 |
0.6211 |
0.5960 |
0.6277 |
1.25e-40 |
4bts:B0, 4bts:C0, 4bts:D0 |
4 |
7ase:w |
147 |
93 |
0.4526 |
0.2925 |
0.4624 |
7.56e-24 |
|
5 |
5jb3:6 |
95 |
83 |
0.2737 |
0.2737 |
0.3133 |
6.80e-10 |
5jbh:6, 6sw9:6, 6swc:6, 6swd:6, 7zag:6, 7zah:6, 7zai:6 |
6 |
6zxg:j |
116 |
88 |
0.2105 |
0.1724 |
0.2273 |
2.74e-04 |
6zxf:j, 6zxh:j |
7 |
4d7e:A |
396 |
52 |
0.2000 |
0.0480 |
0.3654 |
0.019 |
4d7e:B |
8 |
4d7e:C |
377 |
44 |
0.1684 |
0.0424 |
0.3636 |
0.096 |
|
9 |
4ouj:A |
281 |
33 |
0.1368 |
0.0463 |
0.3939 |
2.2 |
4ouj:B |
10 |
5ju6:A |
835 |
40 |
0.1263 |
0.0144 |
0.3000 |
2.7 |
5ju6:B, 5ju6:C, 5ju6:D |
11 |
6jmv:A |
256 |
23 |
0.1158 |
0.0430 |
0.4783 |
2.9 |
8bst:A, 8bst:B, 8bst:C, 8bst:D, 8bsu:A, 8bsu:D, 8bsu:B, 8bsu:C, 8bsu:E, 8bsu:H, 8bsu:F, 8bsu:G, 4e0w:A, 6f28:A, 6f28:B, 6f29:A, 4g8n:A, 4igr:A, 6jmv:B, 4mh5:A, 5nf6:B, 5nf6:A, 4nwc:A, 4nwd:A, 5o4f:B, 5o4f:A, 3s9e:A, 3s9e:B, 3u92:A, 3u92:B, 3u93:A, 3u93:B, 3u94:A, 3u94:B, 3u94:C, 3u94:D |
12 |
5juy:B |
1234 |
66 |
0.1895 |
0.0146 |
0.2727 |
3.4 |
1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D |
13 |
7tfk:A |
360 |
37 |
0.1053 |
0.0278 |
0.2703 |
4.4 |
7tfl:A |
14 |
8dr5:A |
646 |
37 |
0.1053 |
0.0155 |
0.2703 |
4.7 |
8dqx:A, 8dqz:A, 8dr0:A, 8dr1:A, 8dr3:A, 8dr4:A, 8dr6:A, 8dr7:A, 1sxj:A, 7tfh:A, 7tfi:A, 7tfj:A, 7thj:A, 7thv:A, 7ti8:A, 7tib:A, 7tic:A, 7tid:A, 7tku:A, 7u19:A, 7u1a:A, 7u1p:A |
15 |
4iv6:B |
383 |
61 |
0.1684 |
0.0418 |
0.2623 |
7.6 |
4iv6:A |