BioLiP

>protein
GPHMVSSAVKCGICRGVDGKYKCPKCGVRYCSLKCYKDAAKHVHKESEQ

The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2n95:A	49	49	1.0000	1.0000	1.0000	1.99e-30
2	2n94:A	48	37	0.4286	0.4375	0.5676	1.37e-06
3	1x4s:A	59	37	0.2857	0.2373	0.3784	0.002
4	6gej:S	208	27	0.2449	0.0577	0.4444	0.002	6gen:S
5	2yqq:A	56	42	0.3265	0.2857	0.3810	0.019
6	8x1c:L	105	35	0.2653	0.1238	0.3714	0.050
7	6sw9:C	61	18	0.2041	0.1639	0.5556	1.2	6swc:C, 6swd:C, 7zag:C, 7zah:C, 7zai:C, 7zhg:C
8	6skg:Bo	43	25	0.2041	0.2326	0.4000	1.4
9	4s28:A	520	23	0.1633	0.0154	0.3478	1.5	4n7q:A, 4s25:A, 4s26:A, 4s26:B, 4s27:A, 4s29:A
10	5ijl:A	943	20	0.1837	0.0095	0.4500	2.3
11	8ppt:B	1191	20	0.1837	0.0076	0.4500	2.3	8ppu:B, 8ppv:B, 6t8h:B
12	6tmf:W	56	18	0.2041	0.1786	0.5556	2.5	6skf:Az, 6skg:Az, 6th6:Az
13	2ecy:A	66	23	0.2245	0.1667	0.4783	4.1
14	5nus:B	74	13	0.1633	0.1081	0.6154	4.4	5obz:B
15	2mdg:A	55	19	0.2041	0.1818	0.5263	5.2
16	6knb:B	1120	20	0.1837	0.0080	0.4500	5.4	6knc:B
17	6k8n:A	668	30	0.2449	0.0180	0.4000	5.5	6k8n:B, 6k8n:C, 6k8n:D, 6k8o:A
18	6s6t:E	472	14	0.1224	0.0127	0.4286	5.8	6s6s:G, 6s6s:E, 6s6s:F, 6s6s:H, 6s6t:F, 6s6t:G, 6s6u:G, 6s6u:H, 6s6u:I, 6s6u:J, 6s6x:G, 6s6x:H, 6s6x:I, 6s6x:J, 6s6x:K, 6s6x:L, 2vdc:G, 2vdc:H, 2vdc:I, 2vdc:J, 2vdc:K, 2vdc:L
19	8haw:A	479	34	0.2245	0.0230	0.3235	7.4	8hav:A, 8haw:B
20	7yj0:D	622	23	0.1837	0.0145	0.3913	7.6	7yj0:A, 7yj0:B, 7yj0:C
21	7zi4:R	101	18	0.1633	0.0792	0.4444	7.9	6hts:R

[Back]