GPHMTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVY
IIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWL
ERGPLEPSEPAVVAAARVGVEWARKPLRFYVRGSPWVSVVDRVAEQ
The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1f6o:A | 211 | 208 | 0.9757 | 0.9526 | 0.9663 | 1.47e-146 | 1bnk:A, 1ewn:A, 1f4r:A, 3qi5:A, 3qi5:B, 3uby:A, 7xfh:K, 7xfj:K, 7xfm:K |
2 | 7zm7:A | 711 | 104 | 0.1311 | 0.0380 | 0.2596 | 0.85 | 7zmb:A, 7zmg:A |
3 | 1hcy:A | 644 | 59 | 0.0874 | 0.0280 | 0.3051 | 5.9 | |
4 | 6l8s:A | 650 | 59 | 0.0874 | 0.0277 | 0.3051 | 6.0 | 1hc1:A, 1hc1:B, 1hc1:C, 1hc1:D, 1hc1:E, 1hc1:F, 6l8s:B, 6l8s:C |
5 | 4x0o:E | 360 | 36 | 0.0583 | 0.0333 | 0.3333 | 8.0 | 5kp2:B, 5v0p:A, 5v0p:B, 4x0o:A, 4x0o:B, 4x0o:D, 4x0o:F, 4x0o:G, 4x0o:H |
6 | 5agy:A | 219 | 32 | 0.0583 | 0.0548 | 0.3750 | 8.4 | 5agy:B, 4chs:A, 4chs:B, 4top:A, 4top:B, 2vo4:A, 2vo4:B |