BioLiP

>protein
GPHMRYVEIHRNLKGLRKYMAEQAKTNLKLKQRMGDMRREIRKSVGQLTTGGMAANKDKQQKIKSILTEALSNQVESALV
DPNNFVVEPRKPVEGATNNDPLLPSIFVYLINIFAKAAISQFINEAGARPETADPVGICVAAILSEPDFLWRGASLIDIL
IAKFRIVCPVLFGYRGSEKTEQGRQRLGWWKESGQWISEQQHMDRMTGLGAGFAAISLRKFALSKKQNPYPPRFYWMAMA
KIVNTPPAEISNTQCVVLKAMVQNYEAKFIEFYGSAAIAALRTALIDFPARAPHKSAAVNSLEVLAQMLKRDTGLDLG

The query sequence (length=318) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6b4h:A	318	318	1.0000	1.0000	1.0000	0.0	6b4h:C
2	6b4e:A	296	258	0.2044	0.2196	0.2519	9.09e-19	3peu:B, 3pev:B, 3rrm:B, 3rrn:B
3	7tbl:e	313	196	0.1258	0.1278	0.2041	0.35
4	8isk:B	848	45	0.0597	0.0224	0.4222	0.98	8isk:A
5	5m0p:A	424	58	0.0566	0.0425	0.3103	2.4	4l40:A, 4l54:A, 5m0n:A, 5m0o:A, 5m0o:C, 5m0p:B
6	1f3o:A	232	38	0.0409	0.0560	0.3421	3.4	1l2t:A, 1l2t:B, 3tif:A, 3tif:B
7	2gru:A	367	44	0.0409	0.0354	0.2955	4.9	2d2x:A, 2d2x:B, 2gru:B
8	7ch3:B	495	62	0.0566	0.0364	0.2903	5.1	7ch3:C, 7ch3:D, 7ch3:E, 7ch3:I, 7ch3:F, 7ch3:G, 7ch3:H, 7ch3:J, 7ch3:K, 7ch3:L, 7cwv:A, 7cwv:B, 7cwv:C, 7cwv:D, 7cwv:E, 7cwv:F, 7cwv:G, 7cwv:H, 7cwv:I, 7cwv:J, 7cwv:K, 7cwv:L
9	7ch3:A	469	62	0.0566	0.0384	0.2903	6.4
10	3jb9:A	1964	73	0.0629	0.0102	0.2740	6.7

[Back]