BioLiP

>protein
GPHMQTLTLSPNLIGFNSNEGEKLLLTSRSREDFFPLSMQFVTQVNQAYCGVASIIMVLNSLGINAPETAQYSPYRVFTQ
DNFFSNEKTKAVIAPEVVARQGMTLDELGRLIASYGVKVKVNHASDTNIEDFRKQVAENLKQDGNFVIVNYLRKEIGQER
GGHISPLAAYNEQTDRFLIMDVSRYKYPPVWVKTTDLWKAMNTVDSVSQKTRGFVFVSKT

The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6tho:A	220	220	1.0000	1.0000	1.0000	1.83e-167	2btw:A, 2btw:B, 2bu3:A, 2bu3:B, 6th5:A, 6th5:B, 6tho:B, 6tjl:A, 6tjl:B
2	6cq2:A	688	103	0.1364	0.0436	0.2913	1.7	6cqi:A
3	6rxt:US	451	46	0.0773	0.0377	0.3696	2.2	6rxu:US, 6rxv:US, 6rxy:US, 6rxz:US
4	7xcm:A	494	118	0.1364	0.0607	0.2542	2.2	7xcm:B, 7xcm:C, 7xcm:D, 7xcm:E, 7xcm:F, 7xcn:A, 7xcn:B, 7xcn:C, 7xcn:D, 7xcn:E, 7xcn:F
5	6muk:A	363	28	0.0500	0.0303	0.3929	2.6
6	1ebd:A	455	62	0.0955	0.0462	0.3387	2.7	1ebd:B
7	6pcm:A	793	124	0.1591	0.0441	0.2823	3.6	6pcm:B
8	5wxu:B	400	67	0.1045	0.0575	0.3433	3.7	5wxu:A, 5wxu:D, 5wxu:F, 5wxu:C, 5wxu:E
9	7wwp:A	420	42	0.0682	0.0357	0.3571	4.1	7wwq:A
10	7obb:A	1510	69	0.0909	0.0132	0.2899	4.5
11	7ob9:A	1535	69	0.0909	0.0130	0.2899	5.0	7oba:A
12	5mqr:A	1082	85	0.0909	0.0185	0.2353	5.0	5mqs:A
13	7vbc:A	1477	69	0.0909	0.0135	0.2899	5.0	7vba:A, 7vbb:A
14	6agm:A	334	57	0.0773	0.0509	0.2982	6.1	6agm:B, 6agm:C, 6agm:D
15	8czq:A	655	61	0.0909	0.0305	0.3279	7.6
16	5og1:A	819	81	0.1045	0.0281	0.2840	8.0	5ofo:C, 5ofo:F, 5ofo:E, 5ofo:D, 5ofo:B, 5ofo:A, 5og1:E, 6rn2:A, 6rn2:B, 6rn2:C, 6rn2:D, 6rn2:F, 6rn2:E, 6rn3:A, 6rn3:B, 6rn3:C, 6rn3:D, 6rn3:E, 6rn4:B, 6rn4:C, 6rn4:D, 6rn4:E
17	7e7q:A	1958	64	0.0818	0.0092	0.2812	9.2

[Back]