GPHMLEREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCN
ALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIME
SGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQC
LPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQE
The query sequence (length=273) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hom:A | 273 | 273 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 4crv:B, 4ct7:B, 2fv2:A, 2fv2:C, 6hom:C, 6hon:A, 6hon:C, 5lsw:A, 5lsw:C, 5ona:B, 5ona:E, 5onb:A, 5onb:C, 5onb:E, 5onb:G |
2 | 4cv5:B | 260 | 265 | 0.5971 | 0.6269 | 0.6151 | 2.46e-112 | |
3 | 2v95:A | 342 | 68 | 0.0842 | 0.0673 | 0.3382 | 0.78 | |
4 | 3ps5:A | 529 | 59 | 0.0659 | 0.0340 | 0.3051 | 2.9 | 1fpr:A, 4gry:A, 4grz:A, 4gs0:B, 4hjq:A, 4hjq:B |
5 | 3jb9:B | 904 | 30 | 0.0440 | 0.0133 | 0.4000 | 5.8 | |
6 | 7n8n:A | 197 | 66 | 0.0696 | 0.0964 | 0.2879 | 5.8 | 7lv8:B, 7lv8:A, 7lv8:F, 7lv8:E, 7lv9:B, 7lv9:A, 7lv9:F, 7lv9:E, 7n8n:C |
7 | 6xf9:D | 426 | 75 | 0.0769 | 0.0493 | 0.2800 | 8.5 | 6xf9:A, 6xf9:B, 6xf9:C, 6xf9:E |
8 | 8btd:SG | 238 | 30 | 0.0403 | 0.0462 | 0.3667 | 9.4 | 8brm:SG, 8bsi:SG, 8bsj:SG, 8btr:SG |
9 | 8fvy:G | 216 | 30 | 0.0403 | 0.0509 | 0.3667 | 9.6 | 8br8:SG, 8g4s:G, 7pwf:G, 7pwo:G1 |