GPHMAVLCGVCGIKEFKYKCPRCLVQTCSLECSKKHKTRDNCSGQTHD
The query sequence (length=48) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2n94:A | 48 | 48 | 1.0000 | 1.0000 | 1.0000 | 5.56e-31 | |
2 | 2n95:A | 49 | 37 | 0.4375 | 0.4286 | 0.5676 | 1.34e-06 | |
3 | 2yqq:A | 56 | 37 | 0.3333 | 0.2857 | 0.4324 | 0.002 | |
4 | 1x4s:A | 59 | 37 | 0.3333 | 0.2712 | 0.4324 | 0.006 | |
5 | 1s0u:A | 391 | 20 | 0.1875 | 0.0230 | 0.4500 | 0.91 | |
6 | 6knb:B | 1120 | 44 | 0.2917 | 0.0125 | 0.3182 | 1.2 | 6knc:B |
7 | 6gej:S | 208 | 29 | 0.2083 | 0.0481 | 0.3448 | 2.0 | 6gen:S |
8 | 5ikf:A | 150 | 39 | 0.2917 | 0.0933 | 0.3590 | 2.4 | |
9 | 2yqp:A | 60 | 36 | 0.2917 | 0.2333 | 0.3889 | 6.0 | |
10 | 6r4o:A | 841 | 13 | 0.1458 | 0.0083 | 0.5385 | 6.6 | |
11 | 1be3:A | 446 | 17 | 0.2083 | 0.0224 | 0.5882 | 8.4 | 2a06:A, 1bgy:A, 1bgy:M, 4d6t:N, 4d6u:A, 4d6u:N, 7dgq:k, 7dgq:w, 7dgr:k, 7dgr:w, 7dgs:k, 7dgs:w, 7dkf:A1, 7dkf:M1, 6fo0:N, 6fo0:A, 6fo2:N, 6fo2:A, 5luf:c, 5luf:l, 5nmi:N, 5nmi:A, 1pp9:A, 1ppj:A, 6qbx:a3, 6qc3:a1, 7tz6:A, 7tz6:N, 2ybb:a, 2ybb:A |
12 | 5yu6:C | 1073 | 22 | 0.2083 | 0.0093 | 0.4545 | 8.6 | 3a6p:A, 3a6p:F, 5yu6:A |
13 | 3mn8:B | 386 | 34 | 0.2500 | 0.0311 | 0.3529 | 8.7 | 3mn8:A, 3mn8:C, 3mn8:D |