GPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEET
KYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVH
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7e34:B | 142 | 142 | 1.0000 | 1.0000 | 1.0000 | 2.36e-105 | |
2 | 3vb9:B | 462 | 81 | 0.1338 | 0.0411 | 0.2346 | 1.3 | 3vb9:D |
3 | 8jb1:A | 468 | 72 | 0.1549 | 0.0470 | 0.3056 | 1.5 | 8jb1:B |
4 | 7w1y:6 | 716 | 66 | 0.1338 | 0.0265 | 0.2879 | 3.1 | 7w1y:E |
5 | 5grb:B | 212 | 47 | 0.0986 | 0.0660 | 0.2979 | 7.1 | 5gq1:A, 5gq1:B, 5gq1:C, 5gq1:D, 5grb:A, 5grb:C, 5grb:D, 5grb:E, 5grb:F |
6 | 6bjb:A | 384 | 75 | 0.1408 | 0.0521 | 0.2667 | 8.0 | 6bjb:B |
7 | 4arz:A | 291 | 53 | 0.0986 | 0.0481 | 0.2642 | 8.5 | 6jwp:A, 6jwp:F, 3r7w:A, 3r7w:C |
8 | 8p23:B | 715 | 26 | 0.0704 | 0.0140 | 0.3846 | 9.1 | 8p23:A, 8p27:A, 8p27:B, 8p28:A, 8p28:B, 8p28:C, 8p28:D, 8p2c:A, 8p2c:B, 8p2c:C, 8p2c:D, 8p2d:A, 8p2d:B, 8p2s:A, 8p2s:B, 8p39:A, 8p39:B |