GNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDP
SSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPL
TVGS
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8r5n:A | 165 | 164 | 1.0000 | 0.9939 | 1.0000 | 5.57e-124 | 8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A |
2 | 9bkr:A | 74 | 67 | 0.1463 | 0.3243 | 0.3582 | 1.20e-08 | 9bks:A, 8tre:A, 7uw7:A |
3 | 9bkr:A | 74 | 71 | 0.1463 | 0.3243 | 0.3380 | 4.56e-06 | 9bks:A, 8tre:A, 7uw7:A |
4 | 2rsf:A | 110 | 65 | 0.1098 | 0.1636 | 0.2769 | 0.58 | |
5 | 5uwa:A | 185 | 54 | 0.1037 | 0.0919 | 0.3148 | 0.72 | 5uwa:B |
6 | 4qpl:A | 153 | 65 | 0.1098 | 0.1176 | 0.2769 | 2.3 | 4qpl:C, 3v3l:A, 3v3l:B |
7 | 3he3:A | 366 | 56 | 0.0976 | 0.0437 | 0.2857 | 2.4 | 3hdq:A, 3hdq:B, 3hdq:C, 3hdq:D, 3hdq:E, 3hdq:F, 3hdq:G, 3hdq:H, 3hdq:I, 3hdq:J, 3hdy:A, 3hdy:B, 3hdy:C, 3hdy:D, 3hdy:E, 3hdy:F, 3hdy:G, 3hdy:H, 3hdy:I, 3hdy:J, 3he3:B, 3he3:C, 3he3:D, 3he3:E, 3he3:F, 3he3:G, 3he3:H, 3he3:I, 3he3:J, 3mj4:A, 3mj4:B, 3mj4:C, 3mj4:D, 3mj4:E, 3mj4:F, 3mj4:G, 3mj4:H, 3mj4:I, 3mj4:J |
8 | 8tl6:B | 353 | 99 | 0.1402 | 0.0652 | 0.2323 | 8.0 | |
9 | 8g7w:B | 1059 | 62 | 0.1159 | 0.0179 | 0.3065 | 9.5 | 8g7w:A |
10 | 7aor:z | 1071 | 65 | 0.1220 | 0.0187 | 0.3077 | 9.9 |