GNSGFYLYNTQNCVFADNTVQDILDKITTDPSLGLLKAFNNFPITNKIQCNGLFTPRNIETLLGGTEIGKFTVTPKSSGS
MFLVSADIIASRMEGGVVLALVREGDSKPYAISYGYSSGVPNLCSLRTRIINTGLTPTTYSLRVGGLESGVVWVNALSNG
NDILGITNTSNVSFLEVIP
The query sequence (length=179) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gjt:E | 181 | 179 | 1.0000 | 0.9890 | 1.0000 | 7.86e-129 | 6gjt:A, 6gjt:B, 6gjt:C, 6gjt:D, 6gjt:F |
2 | 8wcn:A | 379 | 62 | 0.1173 | 0.0554 | 0.3387 | 0.14 | 8wcn:B |
3 | 7uxa:D | 264 | 59 | 0.1061 | 0.0720 | 0.3220 | 0.87 | 7zrz:CP1 |
4 | 8iss:D | 289 | 59 | 0.1061 | 0.0657 | 0.3220 | 1.0 | 8hmy:C, 8hmz:C |
5 | 4pyt:A | 302 | 155 | 0.2346 | 0.1391 | 0.2710 | 2.0 | |
6 | 2g02:A | 404 | 47 | 0.0894 | 0.0396 | 0.3404 | 2.1 | 2g0d:A |
7 | 1gm9:A | 207 | 63 | 0.0950 | 0.0821 | 0.2698 | 4.7 | 1fxh:A, 1fxv:A, 1k7d:A, 1kec:A |