GNRRPIWIMGAMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSK
YQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDK
VGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGV
DGIMTNYPDVITDVLNEAAYKKKFRVATYDDNPWVTFK
The query sequence (length=278) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4rw3:A | 279 | 278 | 0.9964 | 0.9928 | 0.9964 | 0.0 | 3rlg:A, 3rlh:A, 4rw5:A |
2 | 2f9r:A | 285 | 283 | 0.6043 | 0.5895 | 0.5936 | 3.02e-117 | 2f9r:B, 2f9r:C, 2f9r:D, 1xx1:A, 1xx1:B, 1xx1:C, 1xx1:D |
3 | 4q6x:A | 278 | 275 | 0.4712 | 0.4712 | 0.4764 | 9.95e-86 | |
4 | 2pz0:B | 243 | 38 | 0.0468 | 0.0535 | 0.3421 | 0.021 | 2pz0:A |
5 | 4r7o:C | 280 | 54 | 0.0540 | 0.0536 | 0.2778 | 0.33 | 4r7o:A, 4r7o:B, 4r7o:D, 4r7o:E, 4r7o:F, 4r7o:G |
6 | 8p5d:SE0 | 260 | 52 | 0.0612 | 0.0654 | 0.3269 | 0.88 | 8p60:SE0, 8p60:RE0, 7qca:SE0 |
7 | 7ym0:A | 301 | 69 | 0.0612 | 0.0565 | 0.2464 | 0.88 | 7ym0:B, 7ymr:A, 7ymr:B, 7ymr:C, 7ymr:D |
8 | 3no3:A | 238 | 36 | 0.0468 | 0.0546 | 0.3611 | 1.2 | |
9 | 5t9c:E | 263 | 34 | 0.0468 | 0.0494 | 0.3824 | 1.7 | 5t91:A, 5t9b:G |
10 | 3l12:A | 297 | 35 | 0.0504 | 0.0471 | 0.4000 | 1.9 | 3l12:B |
11 | 5bk7:H | 369 | 40 | 0.0540 | 0.0407 | 0.3750 | 2.7 | 5bk7:A, 5bk7:B, 5bk7:C, 5bk7:D, 5bk7:E, 5bk7:F, 5bk7:G, 6c8t:A, 6c8t:B, 6c8t:C, 6c92:A, 6c92:B, 6c92:C, 6c92:D, 6c9b:B, 5dj3:A, 5dj3:B, 5dj3:C, 5dj3:D |
12 | 2oog:D | 268 | 42 | 0.0540 | 0.0560 | 0.3571 | 5.0 | 2oog:A, 2oog:B, 2oog:C, 2oog:E, 2oog:F |
13 | 3af5:A | 638 | 60 | 0.0504 | 0.0219 | 0.2333 | 6.2 | 3af6:A |
14 | 1w4x:A | 533 | 151 | 0.1331 | 0.0694 | 0.2450 | 7.7 | 4c74:A, 4c77:A, 4d03:A, 4d04:A, 4ovi:A, 2ylr:A, 2yls:A, 2ylt:A, 2ylw:A, 2ylx:A, 2ylz:A, 2ym1:A, 2ym2:A |
15 | 2vsq:A | 1273 | 40 | 0.0468 | 0.0102 | 0.3250 | 9.2 |