GNGEYAWYYEGRNGWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVA
GLRLD
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4qpl:A | 153 | 84 | 0.9882 | 0.5490 | 1.0000 | 3.64e-59 | 4qpl:C, 3v3l:A, 3v3l:B |
2 | 2rsf:A | 110 | 81 | 0.9412 | 0.7273 | 0.9877 | 2.17e-56 | |
3 | 5vzt:B | 418 | 39 | 0.1529 | 0.0311 | 0.3333 | 1.3 | 5vzt:D, 5vzu:B, 5vzu:D |
4 | 1yiq:A | 684 | 52 | 0.2000 | 0.0249 | 0.3269 | 2.8 | |
5 | 8tc0:B | 1091 | 21 | 0.1059 | 0.0082 | 0.4286 | 3.1 | 8tc0:A, 8tc0:C, 8tc1:C, 8tc1:A, 8tc1:B, 8tc5:C, 8tc5:A, 8tc5:B, 1zv8:A, 1zv8:C, 1zv8:E, 5zvm:A, 5zvm:B |
6 | 8h10:A | 1026 | 21 | 0.1059 | 0.0088 | 0.4286 | 4.2 | 8h0y:B, 8h0z:A, 8h10:B, 8h10:C, 7zh1:A, 7zh1:B, 7zh1:C, 7zh2:A, 7zh2:B, 7zh2:C |
7 | 8h0z:B | 1045 | 21 | 0.1059 | 0.0086 | 0.4286 | 4.2 | 8h0x:A, 8h0x:B, 8h0x:C, 8h0y:A, 8h0y:C, 8h0z:C, 8h14:B, 8h14:C, 8h14:A |
8 | 3j7a:N | 98 | 45 | 0.1412 | 0.1224 | 0.2667 | 4.3 | 3jbn:N, 3jbo:N, 3jbp:N, 6okk:N, 8tpu:SN |
9 | 5umw:B | 134 | 38 | 0.1647 | 0.1045 | 0.3684 | 7.0 | 5umw:E, 5umw:A |
10 | 8r5n:A | 165 | 54 | 0.1647 | 0.0848 | 0.2593 | 7.9 | 8r5n:B, 8r6a:A, 8r6a:B, 8r6b:A |
11 | 5ups:A | 520 | 46 | 0.1529 | 0.0250 | 0.2826 | 9.2 | 5upq:A, 5upq:B, 5ups:B, 5upt:A |