GNDTTTKPDLYYLKNSEAINSLALLPPPPAVGSIAFLNDQAMYEQGRLLRNTERGKLAAEDANLSSGGVANAFSGAFGSP
ITEKDAPALHKLLTNMIEDAGDLATRSAKDHYMRIRPFAFYGVSTCNTTEQDKLSKNGSYPSGHTSIGWATALVLAEINP
QRQNEILKRGYELGQSRVICGYHWQSDVDAARVVGSAVVATLHTNPAFQQQLQKAKAEFAQH
The query sequence (length=222) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1d2t:A | 222 | 222 | 0.9910 | 0.9910 | 0.9910 | 1.32e-165 | 1eoi:A, 1eoi:B, 1eoi:C |
2 | 2a96:B | 219 | 203 | 0.4279 | 0.4338 | 0.4680 | 1.13e-62 | 2a96:A, 2a96:C, 2a96:D, 2akc:A, 2akc:B, 2akc:C, 2akc:D |
3 | 6pe2:A | 456 | 78 | 0.0991 | 0.0482 | 0.2821 | 0.017 | 6p5a:A, 6p5a:G, 6pe2:G |
4 | 1krh:A | 337 | 73 | 0.0856 | 0.0564 | 0.2603 | 7.7 | 1krh:B |