GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPKCRMNKK
NKPRCVCAPDCSNKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNR
ICPEPSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCP
DSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSI
The query sequence (length=282) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2p6a:C | 282 | 282 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1lr7:A, 1lr8:A |
2 | 7kbu:A | 221 | 90 | 0.0957 | 0.1222 | 0.3000 | 9.91e-05 | 7kbu:B |
3 | 7kbu:A | 221 | 88 | 0.0993 | 0.1267 | 0.3182 | 0.002 | 7kbu:B |
4 | 7kbu:A | 221 | 82 | 0.0993 | 0.1267 | 0.3415 | 0.028 | 7kbu:B |
5 | 1bmo:A | 233 | 90 | 0.0993 | 0.1202 | 0.3111 | 3.58e-04 | 1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
6 | 1bmo:A | 233 | 79 | 0.0887 | 0.1073 | 0.3165 | 0.11 | 1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
7 | 6fyq:A | 443 | 46 | 0.0461 | 0.0293 | 0.2826 | 1.8 | |
8 | 2ble:A | 337 | 47 | 0.0496 | 0.0415 | 0.2979 | 7.6 | 2bwg:A, 2bwg:B, 2bwg:C, 2bwg:D |