BioLiP

>protein
GMVVFIDPGHNGANDASIGRQVPTGRGGTKNCQASGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDNALGPC
VDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSD
LAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQG

The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4m6g:A	214	212	0.9953	0.9907	1.0000	1.42e-156	4lq6:A, 4m6i:A, 4m6i:B
2	7agm:A	218	212	0.7981	0.7798	0.8019	2.02e-129	7agm:B
3	7ago:A	214	210	0.6432	0.6402	0.6524	2.14e-105	7agl:A
4	5j72:A	638	196	0.2441	0.0815	0.2653	3.61e-10	5j72:B
5	8c0j:A	200	220	0.2911	0.3100	0.2818	1.69e-07	8c0j:C
6	7tj4:B	176	213	0.2207	0.2670	0.2207	1.17e-05	7tj4:D
7	5emi:A	180	211	0.2535	0.3000	0.2559	2.44e-05
8	4rn7:A	186	214	0.2254	0.2581	0.2243	2.73e-05
9	8c2o:A	228	241	0.2441	0.2281	0.2158	3.57e-05	8c2o:B
10	4bin:A	348	236	0.2254	0.1379	0.2034	0.001
11	1jwq:A	179	208	0.2207	0.2626	0.2260	0.008
12	7rag:B	197	171	0.1643	0.1777	0.2047	0.011
13	3ne8:A	226	81	0.1033	0.0973	0.2716	0.28
14	5ikb:A	249	33	0.0657	0.0562	0.4242	1.5
15	3be7:A	398	49	0.0798	0.0427	0.3469	4.4	3be7:E, 3be7:B, 3be7:D, 3be7:C, 3be7:F, 3be7:G, 3be7:H, 3dug:A, 3dug:B, 3dug:C, 3dug:D, 3dug:E, 3dug:F, 3dug:G, 3dug:H

[Back]