GMTRIASHRGGTLEFGDSTPHGFTATAAMALEEVEFDLHPTADGAIVVHHDPTLDATTDMTGAIVDMTLAKVKTATIRYG
AGSHPMTLEELCALYVDSHVNFRCEIKPGVDGLPYEGFVALVIAGLERHSMLERTTFSSFLLASMDELWKATTRPRLWLV
SPSVLQQLGPGAVIETAIAHSIHEIGVHIDTADAGLMAQVQAAGLDFGCWAAHTPSQITKALDLGVKVFTTDRPTLAIAL
RTEHRMEAS
The query sequence (length=249) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ks6:A | 250 | 249 | 1.0000 | 0.9960 | 1.0000 | 0.0 | 3ks5:A, 3ks5:B, 3ks6:B, 3ks6:C, 3ks6:D |
2 | 2pz0:B | 243 | 243 | 0.2610 | 0.2675 | 0.2675 | 1.89e-16 | 2pz0:A |
3 | 4oec:A | 248 | 87 | 0.1245 | 0.1250 | 0.3563 | 1.34e-09 | 4oec:B, 4oec:C, 4oec:D |
4 | 5t9c:E | 263 | 140 | 0.1687 | 0.1597 | 0.3000 | 1.98e-08 | 5t91:A, 5t9b:G |
5 | 2oog:D | 268 | 195 | 0.2088 | 0.1940 | 0.2667 | 3.74e-07 | 2oog:A, 2oog:B, 2oog:C, 2oog:E, 2oog:F |
6 | 4r7o:C | 280 | 151 | 0.1647 | 0.1464 | 0.2715 | 5.99e-07 | 4r7o:A, 4r7o:B, 4r7o:D, 4r7o:E, 4r7o:F, 4r7o:G |
7 | 3l12:A | 297 | 274 | 0.3052 | 0.2559 | 0.2774 | 1.04e-06 | 3l12:B |
8 | 8ghh:A | 276 | 151 | 0.1566 | 0.1413 | 0.2583 | 1.23e-06 | 8ghi:A |
9 | 3qvq:A | 251 | 245 | 0.2369 | 0.2351 | 0.2408 | 2.88e-06 | 3qvq:B, 3qvq:C, 3qvq:D |
10 | 7ym0:A | 301 | 66 | 0.0924 | 0.0764 | 0.3485 | 4.07e-05 | 7ym0:B, 7ymr:A, 7ymr:B, 7ymr:C, 7ymr:D |
11 | 7e2b:A | 253 | 90 | 0.0964 | 0.0949 | 0.2667 | 4.50e-05 | |
12 | 3no3:A | 238 | 241 | 0.2169 | 0.2269 | 0.2241 | 7.11e-05 | |
13 | 5vug:A | 268 | 112 | 0.1124 | 0.1045 | 0.2500 | 0.19 | |
14 | 7ww4:A | 480 | 238 | 0.2048 | 0.1062 | 0.2143 | 0.73 | 7wwc:A |
15 | 8cwp:A | 327 | 82 | 0.0924 | 0.0703 | 0.2805 | 0.76 | |
16 | 5gjo:A | 385 | 102 | 0.1084 | 0.0701 | 0.2647 | 0.94 | 5gjn:A, 5gjo:B, 5gjp:A |
17 | 6jij:C | 298 | 51 | 0.0683 | 0.0570 | 0.3333 | 1.1 | 6jij:B, 6jij:A |
18 | 6kfs:A | 248 | 62 | 0.0763 | 0.0766 | 0.3065 | 1.8 | |
19 | 6ik5:A | 705 | 32 | 0.0442 | 0.0156 | 0.3438 | 4.4 | 6ik5:B, 6ik6:A, 6ik6:B, 6ik7:B, 6ik7:A, 6ik8:B, 6ik8:A, 3w5f:A, 3w5g:A, 3w5g:B |
20 | 5dw8:A | 260 | 36 | 0.0562 | 0.0538 | 0.3889 | 5.3 | 5dw8:B, 5j16:A, 5j16:B, 5j16:C, 5j16:D |
21 | 9eoc:B | 485 | 58 | 0.0884 | 0.0454 | 0.3793 | 5.6 | |
22 | 3d23:B | 301 | 39 | 0.0562 | 0.0465 | 0.3590 | 5.6 | 3d23:A, 3d23:C, 3d23:D |
23 | 4i58:A | 451 | 28 | 0.0562 | 0.0310 | 0.5000 | 5.7 | 4i58:B, 4i58:C, 4i58:D, 4i59:A, 4i59:B, 4i59:C, 4i59:D |
24 | 1t8q:B | 329 | 90 | 0.0964 | 0.0729 | 0.2667 | 6.1 | 1t8q:A, 1t8q:C, 1t8q:D, 1ydy:A, 1ydy:B |
25 | 5u8u:D | 477 | 56 | 0.0843 | 0.0440 | 0.3750 | 6.9 | 1lpf:A, 1lpf:B, 5u8u:A, 5u8u:B, 5u8u:C, 5u8v:A, 5u8v:B, 5u8v:C, 5u8v:D, 5u8w:A, 5u8w:B, 5u8w:C, 5u8w:D |
26 | 1rv8:B | 305 | 37 | 0.0522 | 0.0426 | 0.3514 | 8.1 | 1rv8:A, 1rv8:C, 1rv8:D, 1rvg:A, 1rvg:B, 1rvg:C, 1rvg:D |
27 | 8tjg:A | 250 | 28 | 0.0522 | 0.0520 | 0.4643 | 8.4 |