GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQEHGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVNG
PRKQV
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4m5s:A | 87 | 86 | 0.9882 | 0.9655 | 0.9767 | 2.76e-55 | 4m5t:A, 4m5t:C, 4m5t:E, 4m5t:G |
2 | 3l1e:A | 105 | 82 | 0.5529 | 0.4476 | 0.5732 | 1.74e-30 | |
3 | 6gjh:F | 87 | 81 | 0.5529 | 0.5402 | 0.5802 | 4.00e-29 | 6gjh:D, 6gjh:H, 6gjh:B, 4mjh:A, 4mjh:C |
4 | 5lum:A | 78 | 73 | 0.5294 | 0.5769 | 0.6164 | 7.08e-29 | 5lum:B, 5lum:D, 5lum:C, 5lum:E |
5 | 6f2r:Q | 89 | 75 | 0.3176 | 0.3034 | 0.3600 | 1.17e-11 | 6f2r:T, 6f2r:V |
6 | 8yo4:A | 442 | 42 | 0.1647 | 0.0317 | 0.3333 | 2.2 | 8ylu:A, 8ylu:B, 8yo4:B, 8yo7:A, 8yo7:B, 8yon:A, 8yon:B |
7 | 2nvv:A | 496 | 45 | 0.1765 | 0.0302 | 0.3333 | 3.2 | 2nvv:B, 2nvv:C, 2nvv:D, 2nvv:E |
8 | 3msu:B | 426 | 27 | 0.0941 | 0.0188 | 0.2963 | 3.5 | 3msu:A |
9 | 5hcc:A | 982 | 81 | 0.3059 | 0.0265 | 0.3210 | 4.2 | 7ad6:A, 8ayh:A, 1cfa:A, 5hcd:A, 5hce:A |
10 | 3a2m:B | 300 | 42 | 0.1294 | 0.0367 | 0.2619 | 4.8 | 3a2l:A, 3a2l:B, 3a2m:A |
11 | 4lvq:A | 319 | 33 | 0.1176 | 0.0313 | 0.3030 | 5.9 | 4lvq:B |
12 | 1txu:A | 254 | 40 | 0.1529 | 0.0512 | 0.3250 | 6.7 |